CATH Domain: 2pqqA00 XML data for domain: 2pqqA00

Molscript image for 2pqqA00
2pqqA00
PDB coordinates for domain 2pqqA00

PDB 2pqq, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.120 Jelly Rolls
2.60.120.10 Jelly Rolls Gene3D
2.60.120.10.22
2.60.120.10.22.1
2.60.120.10.22.1.1
2.60.120.10.22.1.1.1
2.60.120.10.22.1.1.1.1

[top]
Segment boundaries for domain 2pqqA00

Chopping figure for domain 2pqqA00
DomainStart PDB ResidueStop PDB Residue
2pqqA00 -1 147

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 2.60.120.10.22.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1o7fA03 83.04 Ras guanyl-nucleotide exchange factor activityCAMP-mediated signalingCytosolMus musculusRap guanine nucleotide exchange factor 4 2.60.120.10 109 19 73 2.20 2.98
1o7fA01 81.37 Ras guanyl-nucleotide exchange factor activityCAMP-mediated signalingCytosolMus musculusRap guanine nucleotide exchange factor 4 2.60.120.10 155 18 77 2.92 3.77
2bgcB01 78.40 Listeria monocytogenesListeriolysin regulatory protein 2.60.120.10 109 11 71 3.27 4.55
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pqqA00
GHDDVLRRNPLFAALDDEQSAELRASSEVTLARGDTLFHEGDPGDRLYVVTEGKVKLHRTSPDGRENLAVVGPSELIGEL
SLFDPGPRTATGTALTEVKLLALGHGDLQPWLNVRPEVATALLRAVARRLRKTNDALVFSDGS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pqqA00
GHXDDVLRRNPLFAALDDEQSAELRASXSEVTLARGDTLFHEGDPGDRLYVVTEGKVKLHRTSPDGRENXLAVVGPSELI
GELSLFDPGPRTATGTALTEVKLLALGHGDLQPWLNVRPEVATALLRAVARRLRKTNDAXSDLVFSDGS
BLAST against CATH

[top]
Domain History Events (12)

Domain assigned by auto on 14 Feb 2008 20:27

Assigning to "2.60.120.10" based on similarity with "2pqqD00"

Flow stage update by auto on 14 Feb 2008 20:25

No in_process hits for Domain "2pqqA00" ready to be processed

Update comment by auto on 14 Feb 2008 20:20

Domain "2pqqA00" hits Domain "2pqqC00" (97.3154362416107% over 100%) which is currently in process

Update comment by auto on 14 Feb 2008 20:09

Domain "2pqqA00" hits Domain "2pqqD00" (97.3154362416107% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2pqqA00" hits Domain "2pqqB00" (97.3154362416107% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2pqqA00" hits Domain "2pqqB00" (97.3154362416107% over 100%) which is currently in process

Update comment by auto on 01 Sep 2007 18:04

Domain "2pqqA00" hits Domain "2pqqB00" (97.3154362416107% over 100%) which is currently in process

Flow stage update by auto on 01 Sep 2007 18:04

Domain "2pqqA00" hits Domain "2pqqB00" (97.3154362416107% over 100%) which is currently in process

Flow stage update by auto on 01 Sep 2007 18:04

NW result present for Domain "2pqqA00"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2pqqA00"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2pqqA00"

Insertion by auto on 23 Aug 2007 14:27

Final ChopClose added based on similarity with "2pqqB"