CATH Domain: 2pq7A00 XML data for domain: 2pq7A00

Molscript image for 2pq7A00
2pq7A00
PDB coordinates for domain 2pq7A00

PDB 2pq7, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.3210 Hypothetical protein af1432
1.10.3210.10 Hypothetical protein af1432 Gene3D
1.10.3210.10.3
1.10.3210.10.3.1
1.10.3210.10.3.1.1
1.10.3210.10.3.1.1.1
1.10.3210.10.3.1.1.1.1

[top]
Segment boundaries for domain 2pq7A00

Chopping figure for domain 2pq7A00
DomainStart PDB ResidueStop PDB Residue
2pq7A00 2 217

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.3210.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2pjqA01 77.28 Lactobacillus plantarumPutative uncharacterized protein lp_2664 1.10.472.50 89 19 51 2.42 4.73
3djbA01 76.91 Bacillus thuringiensis serovar konkukianHydrolase, HD family 1.10.472.50 93 22 53 2.36 4.41
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pq7A00
NLTELERIPHLREILNIVREAFKDYDDPAHDISHTFRVENASEIASREKCDLQKAIIAALLHDIKRPHEALTGVDHAESG
AEYASGLLPTGFDISFVAEVSKAIRSHRTPTSLTGKILQDADRLDAIGAVAIARVFSYPETFWTETARKAEDRYSFVVEF
VQRFLAEWG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pq7A00
GXNLTELXERIPHLREILNIVREAFKDYDDPAHDISHTFRVXENASEIASREKCDLQKAIIAALLHDIKRPHEALTGVDH
AESGAEYASGLLPTXGFDISFVAEVSKAIRSHRYSGGLTPTSLTGKILQDADRLDAIGAVAIARVFSYPETFWTETARKX
AEDRYSFVVEFVQRFLAEWGQI
BLAST against CATH

[top]
Domain History Events (73)

Domain assigned by cuff on 08 Mar 2008 11:26

same superfamily

Domain assignment manual match h by cuff on 08 Mar 2008 11:24

ample evidence for homology

Domain assignment manual match t by tronnberg on 20 Sep 2007 09:53

SSAP: 78.9 OV: 81 SEQ: 15. Reasonable similar linkage and structure (differ with a alfa helix). Functionally similar (both are hydrolases).

Homcheck review by tronnberg on 20 Sep 2007 09:53

SSAP: 78.9 OV: 81 SEQ: 15. Reasonable similar linkage and structure (differ with a alfa helix). Functionally similar (both are hydrolases).

Flow stage update by tronnberg on 20 Sep 2007 09:53

SSAP: 78.9 OV: 81 SEQ: 15. Reasonable similar linkage and structure (differ with a alfa helix). Functionally similar (both are hydrolases).

Homcheck allotment by tronnberg on 20 Sep 2007 09:50

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 20 Sep 2007 09:50

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 17 Sep 2007 12:52

Domain "2pq7A00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 17 Sep 2007 12:51

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pq7A00

Flow stage update by auto on 17 Sep 2007 11:43

Retrieved PRC_PFAMCATH results for job ID SID5606290212793496 and results inserted.

Domain scan prc pfamcath by auto on 17 Sep 2007 11:42

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 28 results for 2pq7A00

Update comment by auto on 16 Sep 2007 22:46

PRC_PFAMCATH job SID5606290212793496 is not yet finished.

Prc pfamcath submit by auto on 16 Sep 2007 22:44

The entry "2pq7A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 16 Sep 2007 22:44

The entry "2pq7A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 16 Sep 2007 22:18

Retrieved SSAP results for job ID SID8564317604494336 and results inserted.

Domain scan ssap cath by auto on 16 Sep 2007 22:16

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 728 results for 2pq7A00

Update comment by auto on 15 Sep 2007 14:25

SSAP job SID8564317604494336 is not yet finished.

Flow stage update by auto on 15 Sep 2007 14:15

The entry "2pq7A00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 15 Sep 2007 14:15

The entry "2pq7A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 07:53

Giving up on SSAP job SID1894777010632664 because submission time of Sun Sep 9 22:44:57 2007 is more than 345600 seconds older than current time (Sat Sep 15 07:53:06 2007).

Update comment by auto on 09 Sep 2007 23:24

SSAP job SID1894777010632664 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:44

The entry "2pq7A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:44

The entry "2pq7A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:15

Giving up on SSAP job SID1893515348378554 because submission time of Wed Sep 5 18:54:50 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:15:52 2007).

Update comment by auto on 05 Sep 2007 20:00

SSAP job SID1893515348378554 is not yet finished.

Flow stage update by auto on 05 Sep 2007 18:54

The entry "2pq7A00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 18:54

The entry "2pq7A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 13:26

Retrieved PRC results for job ID SID6617185058082944 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 13:25

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 15 results for 2pq7A00

Prc cath submit by auto on 05 Sep 2007 04:28

The entry "2pq7A00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 04:28

The entry "2pq7A00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 01:09

Retrieved HMM(SAM) results for job ID SID8140798731547904 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 01:08

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 6 results for 2pq7A00

Update comment by auto on 04 Sep 2007 13:24

HMM(SAM) job SID8140798731547904 is not yet finished.

Flow stage update by auto on 04 Sep 2007 10:29

The entry "2pq7A00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Sep 2007 10:29

The entry "2pq7A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 06:44

Retrieved "2pq7A00" CATHEDRAL results for job ID SID5667551241343712 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 06:43

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 15 results for 2pq7A00

Cathedral cath submit by auto on 03 Sep 2007 14:30

The entry "2pq7A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:30

The entry "2pq7A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:47

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pq7A00.scanlist" for "2pq7A00"

Write scan list by auto on 03 Sep 2007 12:47

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pq7A00.scanlist" for domain "2pq7A00"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:33

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:23

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:13

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:16

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:42

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:16

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:33

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:07

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:17

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:12

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:33

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:38

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:17

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:43

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:05

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:24

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:30

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 18:35

Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 28 Aug 2007 18:29

No satisfactory AssignClose result found.

Flow stage update by auto on 28 Aug 2007 18:20

No in_process hits for Domain "2pq7A00" ready to be processed

Flow stage update by auto on 28 Aug 2007 18:20

NW result present for Domain "2pq7A00"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2pq7A00"

Flow stage update by auto on 16 Aug 2007 17:14

Beginning processing for Domain "2pq7A00"

Insertion by cuff on 16 Aug 2007 15:45

nice chopping