CATH Domain: 2ppqA02

2ppqA02

PDB 2ppq, Chain A, Domain 2

CATH Code	Level Description	Links
3	Alpha Beta
3.90	Alpha-Beta Complex
3.90.1200	Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2
3.90.1200.10		Gene3D
3.90.1200.10.3
3.90.1200.10.3.1
3.90.1200.10.3.1.1
3.90.1200.10.3.1.1.1
3.90.1200.10.3.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2ppqA02

Domain	Start PDB Residue	Stop PDB Residue
2ppqA01	5	104
2ppqA02	106	319

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.90.1200.10.3.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	3fi8A02	78.99	Plasmodium falciparum 3D7Glycerophospholipid metabolismCholine kinaseCholine kinase [EC:2.7.1.32]Metabolic pathways	3.90.1200.10	257	14	76	3.25	4.24
	2qg7D02	77.73	Ethanolamine kinase [EC:2.7.1.82]Glycerophospholipid metabolismPlasmodium vivaxEthanolamine kinase, putativeMetabolic pathways	3.90.1200.10	261	11	74	3.20	4.28

[top]
Domain ATOM Sequence

>pdb|2ppqA02
EGWLRKPEAKHCREVGKALAAHLASEGFEIKRPNALSVDGWKVLWDKSEERADEVEKGLREEIRPEIDYLAAHWPKDLPA
GVIHADLFQDNVFFLGDELSGLIDFYFACNDLLAYDVSICLNAWCFEKDGAYNVTKGKALLEGYQSVRPLSEAELEALPL
LSRGSALRFFLTRLYDWLTTPAGALVVKKDPLEYLRKLRFHRTIANVAEYGL

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2ppqA02
EGXWLRKPEAKHCREVGKALAAXHLASEGFEIKRPNALSVDGWKVLWDKSEERADEVEKGLREEIRPEIDYLAAHWPKDL
PAGVIHADLFQDNVFFLGDELSGLIDFYFACNDLLAYDVSICLNAWCFEKDGAYNVTKGKALLEGYQSVRPLSEAELEAL
PLLSRGSALRFFLTRLYDWLTTPAGALVVKKDPLEYLRKLRFHRTIANVAEYGL

BLAST against CATH

[top]
Domain History Events (58)

Domain assigned by cuff on 04 Apr 2008 14:53

same superfamily

Domain assignment manual match h by cuff on 04 Apr 2008 14:52

same function, good scores, same superfamily in scop

Domain assignment manual match t by tronnberg on 20 Sep 2007 09:42

SSAP: 79.3 OV: 77 SEQ: 12. Reasonable similar linkage and structure. Functionally different. None of the matches on the scan list with a SSAP score of at least 70 has the same function as the query.

Homcheck review by tronnberg on 20 Sep 2007 09:42

SSAP: 79.3 OV: 77 SEQ: 12. Reasonable similar linkage and structure. Functionally different. None of the matches on the scan list with a SSAP score of at least 70 has the same function as the query.

Flow stage update by tronnberg on 20 Sep 2007 09:42

SSAP: 79.3 OV: 77 SEQ: 12. Reasonable similar linkage and structure. Functionally different. None of the matches on the scan list with a SSAP score of at least 70 has the same function as the query.

Homcheck allotment by tronnberg on 20 Sep 2007 09:39

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 20 Sep 2007 09:39

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 17 Sep 2007 12:50

Domain "2ppqA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 17 Sep 2007 12:49

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2ppqA02

Flow stage update by auto on 17 Sep 2007 11:41

Retrieved PRC_PFAMCATH results for job ID SID5781874743926528 and results inserted.

Domain scan prc pfamcath by auto on 17 Sep 2007 11:40

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 386 results for 2ppqA02

Update comment by auto on 17 Sep 2007 06:33

PRC_PFAMCATH job SID5781874743926528 is not yet finished.

Flow stage update by auto on 17 Sep 2007 06:32

The entry "2ppqA02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 17 Sep 2007 06:31

The entry "2ppqA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 17 Sep 2007 06:12

Retrieved SSAP results for job ID SID3365198028155840 and results inserted.

Domain scan ssap cath by auto on 17 Sep 2007 06:11

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 324 results for 2ppqA02