Domain assigned by cuff on 03 Apr 2008 13:59
same superfamily
CATH Domain: 2pokA02
2pokA02
PDB 2pok, Chain A, Domain 2
| CATH Code | Level Description | Links |
|---|---|---|
 3
| Alpha Beta | |
 3.30
| 2-Layer Sandwich | |
 3.30.70
| Alpha-Beta Plaits | |
 3.30.70.360
| Gene3D | |
 3.30.70.360.11
| ||
 3.30.70.360.11.1
| ||
 3.30.70.360.11.1.1
| ||
 3.30.70.360.11.1.1.1
| ||
 3.30.70.360.11.1.1.1.1
|
Segment boundaries for domain 2pokA02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2pokA01 | 0 | 200 |
| 2pokA01 | 371 | 457 |
| 2pokA02 | 201 | 370 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2pokA02 KGIVTFDAKVKSADVDIHSSYGGVVESAPWYLLQALQSLRAADGRILVEGLYEEVQEPNEREMALLETYGQRNPEEVSRI YGLELPLLQEERMAFLKRFFFDPALNIEGIQSGYQGQGVKTILPAEASAKLEVRLVPGLEPHDVLEKIRKQLDKNGFDKV ELYYTLGEMS
Domain History Events (68)
Domain assignment manual match h by tronnberg on 20 Sep 2007 09:17
SSAP: 75.6 OV: 62 SEQ: 9. Similkar linkage. The structure differs with a three alfa helices located on a linker. Same function as peptidases. I am not sure if the structures are similar enough to assigned the query to the same homology as the match...
Homcheck review by tronnberg on 20 Sep 2007 09:17
SSAP: 75.6 OV: 62 SEQ: 9. Similkar linkage. The structure differs with a three alfa helices located on a linker. Same function as peptidases. I am not sure if the structures are similar enough to assigned the query to the same homology as the match...
Flow stage update by tronnberg on 20 Sep 2007 09:17
SSAP: 75.6 OV: 62 SEQ: 9. Similkar linkage. The structure differs with a three alfa helices located on a linker. Same function as peptidases. I am not sure if the structures are similar enough to assigned the query to the same homology as the match...
Homcheck allotment by tronnberg on 20 Sep 2007 09:11
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 20 Sep 2007 09:11
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 15 Sep 2007 21:38
Domain "2pokA02" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 15 Sep 2007 21:37
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pokA02
Flow stage update by auto on 15 Sep 2007 18:05
Retrieved PRC_PFAMCATH results for job ID SID1896518666108888 and results inserted.
Domain scan prc pfamcath by auto on 15 Sep 2007 18:04
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 11 results for 2pokA02
Update comment by auto on 15 Sep 2007 09:30
PRC_PFAMCATH job SID1896518666108888 is not yet finished.
Prc pfamcath submit by auto on 15 Sep 2007 08:58
The entry "2pokA02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 15 Sep 2007 08:58
The entry "2pokA02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 15 Sep 2007 07:42
Retrieved SSAP results for job ID SID6226935407323504 and results inserted.
Domain scan ssap cath by auto on 15 Sep 2007 07:40
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 693 results for 2pokA02
Update comment by auto on 09 Sep 2007 23:23
SSAP job SID6226935407323504 is not yet finished.
Flow stage update by auto on 09 Sep 2007 22:44
The entry "2pokA02" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 09 Sep 2007 22:44
The entry "2pokA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 20:15
Giving up on SSAP job SID2767625696685728 because submission time of Wed Sep 5 18:53:57 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:15:04 2007).
Update comment by auto on 05 Sep 2007 19:59
SSAP job SID2767625696685728 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 18:53
The entry "2pokA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 18:53
The entry "2pokA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 13:17
Retrieved PRC results for job ID SID3904365009451648 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 13:17
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 9 results for 2pokA02
Flow stage update by auto on 05 Sep 2007 04:26
The entry "2pokA02" has been submitted to the PRC webservice.
Prc cath submit by auto on 05 Sep 2007 04:26
The entry "2pokA02" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 01:02
Retrieved HMM(SAM) results for job ID SID9793542202972656 and inserted them into the database.
Domain scan sam cath by auto on 05 Sep 2007 01:01
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 5 results for 2pokA02
Update comment by auto on 04 Sep 2007 13:24
HMM(SAM) job SID9793542202972656 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 10:28
The entry "2pokA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 10:28
The entry "2pokA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 06:33
Retrieved "2pokA02" CATHEDRAL results for job ID SID7679287872437968 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 06:32
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 188 results for 2pokA02
Cathedral cath submit by auto on 03 Sep 2007 14:30
The entry "2pokA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 14:30
The entry "2pokA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 12:46
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pokA02.scanlist" for "2pokA02"
Write scan list by auto on 03 Sep 2007 12:45
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pokA02.scanlist" for domain "2pokA02"
Update comment by auto on 03 Sep 2007 10:11
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:32
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:37
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:33
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:22
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:23
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:16
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:29
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:13
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:16
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:17
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:42
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:16
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:33
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:07
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 16:17
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 10:12
Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 06:33
Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 02:38
Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 22:17
Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 14:43
Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 09:05
Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 02:24
Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 22:30
Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 18:34
Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 28 Aug 2007 18:29
No satisfactory AssignClose result found.
Flow stage update by auto on 28 Aug 2007 18:20
No in_process hits for Domain "2pokA02" ready to be processed
Flow stage update by auto on 28 Aug 2007 18:20
NW result present for Domain "2pokA02"
Flow stage update by auto on 22 Aug 2007 10:07
All required files are present for Domain "2pokA02"
Flow stage update by auto on 21 Aug 2007 17:49
Beginning processing for Domain "2pokA02"
Insertion by cuff on 21 Aug 2007 11:09
nice chopping
