CATH Domain: 2pokA01 XML data for domain: 2pokA01

Molscript image for 2pokA01
2pokA01
PDB coordinates for domain 2pokA01

PDB 2pok, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.630 Aminopeptidase
3.40.630.10 Zn peptidases Gene3D
3.40.630.10.6
3.40.630.10.6.1
3.40.630.10.6.1.1
3.40.630.10.6.1.1.1
3.40.630.10.6.1.1.1.1

[top]
Segment boundaries for domain 2pokA01

Chopping figure for domain 2pokA01
DomainStart PDB ResidueStop PDB Residue
2pokA01 0 200
2pokA01 371 457
2pokA02 201 370

Structural Neighbourhood (17 entries)

There are 17 matching structural neighberhood comparisons for CATH ID 3.40.630.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 17 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vgyA01 84.53 Succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]Neisseria meningitidis serogroup BLysine biosynthesisMetabolic pathwaysSuccinyl-diaminopimelate desuccinylase 3.40.630.10 256 19 88 2.47 2.79
1lfwA01 83.97 Lactobacillus delbrueckii subsp. lactisBeta-Ala-Xaa dipeptidase 3.40.630.10 274 20 89 3.66 4.10
1cg2A01 82.03 Pseudomonas sp. RS-16Carboxypeptidase G2 3.40.630.10 279 17 93 3.83 4.10
2rb7A01 81.29 Peptidase, M20/M25/M40 familyDesulfovibrio desulfuricans subsp. desulfuricans str. G20 3.40.630.10 231 20 79 3.18 4.00
3ct9B01 81.21 Bacteroides thetaiotaomicronAcetylornithine deacetylase 3.40.630.10 233 18 80 2.99 3.71
2qyvA01 80.51 Arginine and proline metabolismGlutathione metabolismHistidine metabolismMetabolic pathwaysXaa-His dipeptidase. Metallo peptidase. MEROPS family M20C 3.40.630.10 250 12 83 2.94 3.51
2greA01 78.97 Aminopeptidase [EC:3.4.11.-]Deblocking aminopeptidaseBacillus cereus ATCC 14579 3.40.630.10 233 15 79 3.46 4.35
1z2lB01 78.85 Purine metabolismZinc ion bindingProtein homodimerization activityAllantoate deiminase [EC:3.5.3.9]Manganese ion binding 3.40.630.10 295 11 83 3.24 3.90
1y0yA01 78.78 Endoglucanase [EC:3.2.1.4]Starch and sucrose metabolismPyrococcus horikoshiiTetrahedral aminopeptidase 3.40.630.10 254 16 80 3.14 3.88
1vheA01 78.44 Bacillus subtilisPutative aminopeptidase ysdC 3.40.630.10 268 13 81 3.41 4.20
1yloA01 77.86 Shigella flexneriPutative uncharacterized protein 3.40.630.10 254 14 79 3.29 4.12
1vhoA01 77.80 Endoglucanase [EC:3.2.1.4]Thermotoga maritimaStarch and sucrose metabolismEndoglucanase 3.40.630.10 237 13 78 3.37 4.28
2glfA01 77.67 Thermotoga maritimaProbable M18 family aminopeptidase 1 3.40.630.10 304 9 79 3.70 4.65
1xmbA01 77.03 Auxin metabolic processArabidopsis thalianaIAA-Ala conjugate hydrolase activityIAA-amino acid hydrolase ILR1-like 2 3.40.630.10 274 11 88 4.26 4.79
2ijzA01 76.62 Aminopeptidase [EC:3.4.11.-]Pseudomonas aeruginosaProbable M18 family aminopeptidase 2 3.40.630.10 272 8 79 3.48 4.38
2v8hA01 75.85 Beta-alanine synthaseLachancea kluyveri 3.40.630.10 315 9 76 3.73 4.90
2cf4A01 75.45 Pyrococcus horikoshiiPutative uncharacterized protein PH0519 3.40.630.10 236 14 77 3.62 4.70
[1]
Displaying entries 1 to 17 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pokA01
AMVFPSEQEQIEKFEKDHVAQHYFEVLRTLISKKSVFAQQVGLKEVANYLGEIFKRVGAEVEIDESYTAPFVMAHFKSSR
PDAKTLIFYNHYDTVPADGDQVWTEDPFTLSVRNGFMYGRGVDDDKGHITARLSALRKYMQHHDDLPVNISFIMEGAEES
ASTDLDKYLEKHADKLRGADLLVWEQGTKNALEQLEISGGNYRSDMSAPAILNVIELAKKFYPQGVSVLPTTAGTGPMHT
VFDALEVPMVAFGLGNANSRDHGGDENVRIADYYTHIELVEELIRSYE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pokA01
AMVFPSEQEQIEKFEKDHVAQHYFEVLRTLISKKSVFAQQVGLKEVANYLGEIFKRVGAEVEIDESYTAPFVMAHFKSSR
PDAKTLIFYNHYDTVPADGDQVWTEDPFTLSVRNGFMYGRGVDDDKGHITARLSALRKYMQHHDDLPVNISFIMEGAEES
ASTDLDKYLEKHADKLRGADLLVWEQGTKNALEQLEISGGNYRSDMSAPAILNVIELAKKFYPQGVSVLPTTAGTGPMHT
VFDALEVPMVAFGLGNANSRDHGGDENVRIADYYTHIELVEELIRSYE
BLAST against CATH

[top]
Domain History Events (150)

Domain assigned by cuff on 18 Feb 2008 14:10

same superfamily

Domain assignment manual match h by tronnberg on 10 Dec 2007 10:25

SSAP: 84.5 OV: 88 SEQ: 19. The match function is unknown. Very similar linkage.

Homcheck review by tronnberg on 10 Dec 2007 10:25

SSAP: 84.5 OV: 88 SEQ: 19. The match function is unknown. Very similar linkage.

Flow stage update by tronnberg on 10 Dec 2007 10:25

SSAP: 84.5 OV: 88 SEQ: 19. The match function is unknown. Very similar linkage.

Homcheck allotment by tronnberg on 10 Dec 2007 10:23

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 10 Dec 2007 10:23

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 09 Dec 2007 14:56

Domain "2pokA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 09 Dec 2007 14:56

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pokA01

Flow stage update by auto on 08 Dec 2007 18:51

Retrieved PRC_PFAMCATH results for job ID SID6546972214933680 and results inserted.

Domain scan prc pfamcath by auto on 08 Dec 2007 18:51

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 70 results for 2pokA01

Update comment by auto on 08 Dec 2007 14:49

PRC_PFAMCATH job SID6546972214933680 is not yet finished.

Prc pfamcath submit by auto on 08 Dec 2007 14:46

The entry "2pokA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Dec 2007 14:46

The entry "2pokA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Dec 2007 14:27

Retrieved SSAP results for job ID SID2536503947256938 and results inserted.

Domain scan ssap cath by auto on 08 Dec 2007 14:26

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 159 results for 2pokA01

Update comment by auto on 05 Dec 2007 22:47

SSAP job SID2536503947256938 is not yet finished.

Ssap cath submit by auto on 05 Dec 2007 22:37

The entry "2pokA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Dec 2007 22:37

The entry "2pokA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Dec 2007 22:32

Retrieved PRC results for job ID SID0524396331398736 and inserted them into the database.

Domain scan prc cath by auto on 05 Dec 2007 22:32

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 25 results for 2pokA01

Update comment by auto on 05 Dec 2007 18:44

PRC job SID0524396331398736 is not yet finished.

Prc cath submit by auto on 05 Dec 2007 18:41

The entry "2pokA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Dec 2007 18:41

The entry "2pokA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Dec 2007 18:34

Retrieved HMM(SAM) results for job ID SID9228267967605680 and inserted them into the database.

Domain scan sam cath by auto on 05 Dec 2007 18:34

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 18 results for 2pokA01

Update comment by auto on 05 Dec 2007 14:42

HMM(SAM) job SID9228267967605680 is not yet finished.

Flow stage update by auto on 05 Dec 2007 14:39

The entry "2pokA01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 05 Dec 2007 14:39

The entry "2pokA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Dec 2007 14:30

Retrieved "2pokA01" CATHEDRAL results for job ID SID4339951373610952 and inserted them into the database.

Domain scan cathedral cath by auto on 05 Dec 2007 14:29

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 472 results for 2pokA01

Update comment by auto on 05 Dec 2007 06:35

"2pokA01" CATHEDRAL job SID4339951373610952 is not yet finished.

Cathedral cath submit by auto on 05 Dec 2007 06:28

The entry "2pokA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 05 Dec 2007 06:28

The entry "2pokA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 05 Dec 2007 03:12

Unable to insert the domain scan results from "2pokA01" CATHEDRAL job SID5889032950335276.

Update comment by auto on 04 Dec 2007 22:59

"2pokA01" CATHEDRAL job SID5889032950335276 is not yet finished.

Cathedral cath submit by auto on 04 Dec 2007 22:50

The entry "2pokA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 04 Dec 2007 22:50

The entry "2pokA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 04 Dec 2007 22:39

ScanList with 11650 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pokA01.scanlist" for "2pokA01"

Write scan list by auto on 04 Dec 2007 22:39

Writing ScanList containing 11650 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pokA01.scanlist" for domain "2pokA01"

Update comment by auto on 04 Dec 2007 18:15

Waiting for 43 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 15:07

Waiting for 127 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 10:15

Waiting for 206 new domains (example : 2vfzA00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 08:39

Waiting for 257 new domains (example : 2rb8A00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 02:35

Waiting for 335 new domains (example : 2r5qA00) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 22:42

Waiting for 410 new domains (example : 2qluA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 18:15

Waiting for 486 new domains (example : 2o2cB01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 14:51

Waiting for 559 new domains (example : 2ihuB03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 10:15

Waiting for 634 new domains (example : 2e2gJ02) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 07:39

Waiting for 665 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 02:41

Waiting for 642 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 22:32

Waiting for 633 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 18:28

Waiting for 582 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 16:54

Waiting for 555 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 10:15

Waiting for 492 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 07:10

Waiting for 574 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 22:15

Waiting for 624 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 18:53

Waiting for 698 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 14:14

Waiting for 787 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 11:42

Waiting for 869 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 06:27

Waiting for 942 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 02:29

Waiting for 1001 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 23:27

Waiting for 1059 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 18:17

Waiting for 1133 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 14:50

Waiting for 1234 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 10:39

Waiting for 1324 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 08:17

Waiting for 1411 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Nov 2007 22:10

Waiting for 1402 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Nov 2007 11:06

Waiting for 1512 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 29 Nov 2007 10:33

Moving these domains back to write scan list as we want to avoid any problems caused by the remediation that occurred whilst they were progressing through their scans.

Update comment by auto on 28 Nov 2007 11:07

PRC_PFAMCATH job SID0543859676514368 is not yet finished.

Flow stage update by auto on 28 Nov 2007 11:06

The entry "2pokA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 28 Nov 2007 11:05

The entry "2pokA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 28 Nov 2007 06:29

Unable to retrieve "2pokA01" PRC_PFAMCATH results for job "SID0874858224888704"

Update comment by auto on 26 Nov 2007 06:43

PRC_PFAMCATH job SID0874858224888704 is not yet finished.

Prc pfamcath submit by auto on 26 Nov 2007 06:42

The entry "2pokA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 26 Nov 2007 06:42

The entry "2pokA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 26 Nov 2007 03:17

Giving up on PRC_PFAMCATH job SID4748740914380352 because submission time of Thu Nov 22 02:33:33 2007 is more than 345600 seconds older than current time (Mon Nov 26 03:17:40 2007).

Update comment by auto on 22 Nov 2007 02:34

PRC_PFAMCATH job SID4748740914380352 is not yet finished.

Prc pfamcath submit by auto on 22 Nov 2007 02:33

The entry "2pokA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 22 Nov 2007 02:33

The entry "2pokA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 22 Nov 2007 02:29

Retrieved SSAP results for job ID SID6139339571203744 and results inserted.

Domain scan ssap cath by auto on 22 Nov 2007 02:28

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 150 results for 2pokA01

Update comment by auto on 18 Nov 2007 10:16

SSAP job SID6139339571203744 is not yet finished.

Ssap cath submit by auto on 18 Nov 2007 10:14

The entry "2pokA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 18 Nov 2007 10:14

The entry "2pokA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 18 Nov 2007 06:15

Giving up on SSAP job SID0409070619782080 because submission time of Wed Nov 14 06:13:55 2007 is more than 345600 seconds older than current time (Sun Nov 18 06:15:46 2007).

Update comment by auto on 14 Nov 2007 06:14

SSAP job SID0409070619782080 is not yet finished.

Flow stage update by auto on 14 Nov 2007 06:13

The entry "2pokA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 14 Nov 2007 06:13

The entry "2pokA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Nov 2007 02:24

Unable to retrieve "2pokA01" SSAP results for job "SID9267013475432904"

Update comment by auto on 13 Nov 2007 12:03

SSAP job SID9267013475432904 is not yet finished.

Ssap cath submit by auto on 13 Nov 2007 11:58

The entry "2pokA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 13 Nov 2007 11:58

The entry "2pokA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 13 Nov 2007 00:47

Unable to retrieve "2pokA01" SSAP results for job "SID0966580622612928"

Update comment by auto on 15 Sep 2007 14:25

SSAP job SID0966580622612928 is not yet finished.

Ssap cath submit by auto on 15 Sep 2007 14:14

The entry "2pokA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 14:14

The entry "2pokA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 07:40

Giving up on SSAP job SID9501807863039360 because submission time of Sun Sep 9 22:44:01 2007 is more than 345600 seconds older than current time (Sat Sep 15 07:40:42 2007).

Update comment by auto on 09 Sep 2007 23:23

SSAP job SID9501807863039360 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:44

The entry "2pokA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:44

The entry "2pokA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:14

Giving up on SSAP job SID2431494771532378 because submission time of Wed Sep 5 18:53:50 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:14:57 2007).

Update comment by auto on 05 Sep 2007 19:59

SSAP job SID2431494771532378 is not yet finished.

Flow stage update by auto on 05 Sep 2007 18:53

The entry "2pokA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 18:53

The entry "2pokA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 13:16

Retrieved PRC results for job ID SID8931066365761456 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 13:15

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 24 results for 2pokA01

Flow stage update by auto on 05 Sep 2007 04:26

The entry "2pokA01" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 04:26

The entry "2pokA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 13:23

Retrieved HMM(SAM) results for job ID SID3637373741925832 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 13:22

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 16 results for 2pokA01

Sam cath submit by auto on 04 Sep 2007 10:28

The entry "2pokA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:28

The entry "2pokA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 06:31

Retrieved "2pokA01" CATHEDRAL results for job ID SID4195030290197184 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 06:30

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 470 results for 2pokA01

Cathedral cath submit by auto on 03 Sep 2007 14:29

The entry "2pokA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:29

The entry "2pokA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:45

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pokA01.scanlist" for "2pokA01"

Write scan list by auto on 03 Sep 2007 12:45

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pokA01.scanlist" for domain "2pokA01"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:33

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:23

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:13

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:16

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:42

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:16

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:33

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:07

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:17

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:12

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:33

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:38

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:17

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:43

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:05

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:24

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:30

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 18:34

Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 28 Aug 2007 18:29

No satisfactory AssignClose result found.

Flow stage update by auto on 28 Aug 2007 18:20

No in_process hits for Domain "2pokA01" ready to be processed

Flow stage update by auto on 28 Aug 2007 18:20

NW result present for Domain "2pokA01"

Flow stage update by auto on 22 Aug 2007 10:07

All required files are present for Domain "2pokA01"

Flow stage update by auto on 21 Aug 2007 17:49

Beginning processing for Domain "2pokA01"

Insertion by cuff on 21 Aug 2007 11:09

nice chopping