CATH Domain: 2pnwA01 XML data for domain: 2pnwA01

Molscript image for 2pnwA01
2pnwA01
PDB coordinates for domain 2pnwA01

PDB 2pnw, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.40 Barwin-like endoglucanases
2.40.40.10 Barwin-like endoglucanases Gene3D
2.40.40.10.2
2.40.40.10.2.1
2.40.40.10.2.1.1
2.40.40.10.2.1.1.1
2.40.40.10.2.1.1.1.1

[top]
Segment boundaries for domain 2pnwA01

Chopping figure for domain 2pnwA01
DomainStart PDB ResidueStop PDB Residue
2pnwA01 5 101
2pnwA01 270 369
2pnwA02 102 262

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2pnwA01
FSIDEVSFRDLPGWGQDDPRKLFPAMATILSHLRNAKPYRTGALGITAAELVSLLELAERGQVNSPEQARQFFETNSVPF
RISPSGFVTAFYEGPIAAAKVPLVAGRALAVDRLIHTFGLPFFIHAPTLTHLDDGKPFARLMLALDTGSAIVGPARGDIF
TGSGFEAGELAGTVRNEADFYILLPRIAAERYR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pnwA01
MSLNTPFSIDEVSFRDLPGWGQDDPRKLFPAMATILSHLRNAKPYRTGALGITAAELVSLLELAERGQVNSPEQARQFFE
TNSVPFRISPAQGKSGFVTAFYEGPIAAAKVPLVAGRALAVDRLIHTFGLPFFIHAPTLTHLDDGKPFARLMLALDTGSA
IVGPARGDIFTGSGFEAGELAGTVRNEADFYILLPRIAAERYRREGHHHHHH
BLAST against CATH

[top]
Domain History Events (72)

Domain assigned by cuff on 16 Apr 2008 17:13

same superfamily

Domain assignment manual match h by cuff on 16 Apr 2008 17:13

same superfamily in scop

Domain assignment manual match a by tronnberg on 19 Sep 2007 16:58

SSAP: 70.1 OV: 51 SEQ: 11. i believe that the query should be assigned to this architecture.

Homcheck review by tronnberg on 19 Sep 2007 16:58

SSAP: 70.1 OV: 51 SEQ: 11. i believe that the query should be assigned to this architecture.

Flow stage update by tronnberg on 19 Sep 2007 16:58

SSAP: 70.1 OV: 51 SEQ: 11. i believe that the query should be assigned to this architecture.

Homcheck allotment by tronnberg on 19 Sep 2007 16:56

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 19 Sep 2007 16:56

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 17 Sep 2007 12:46

Domain "2pnwA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 17 Sep 2007 12:45

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pnwA01

Flow stage update by auto on 17 Sep 2007 11:37

Retrieved PRC_PFAMCATH results for job ID SID2843249748352528 and results inserted.

Domain scan prc pfamcath by auto on 17 Sep 2007 11:36

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 1 results for 2pnwA01

Update comment by auto on 16 Sep 2007 14:40

PRC_PFAMCATH job SID2843249748352528 is not yet finished.

Prc pfamcath submit by auto on 16 Sep 2007 14:39

The entry "2pnwA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 16 Sep 2007 14:39

The entry "2pnwA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 16 Sep 2007 14:13

Retrieved SSAP results for job ID SID9990156601486240 and results inserted.

Domain scan ssap cath by auto on 16 Sep 2007 14:12

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 76 results for 2pnwA01

Update comment by auto on 15 Sep 2007 14:25

SSAP job SID9990156601486240 is not yet finished.

Ssap cath submit by auto on 15 Sep 2007 14:14

The entry "2pnwA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 14:14

The entry "2pnwA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 07:39

Giving up on SSAP job SID8738609138787376 because submission time of Sun Sep 9 22:43:31 2007 is more than 345600 seconds older than current time (Sat Sep 15 07:39:20 2007).

Update comment by auto on 09 Sep 2007 23:22

SSAP job SID8738609138787376 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:43

The entry "2pnwA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:43

The entry "2pnwA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:14

Giving up on SSAP job SID5027763503812503 because submission time of Wed Sep 5 18:53:17 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:14:30 2007).

Update comment by auto on 05 Sep 2007 19:58

SSAP job SID5027763503812503 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 18:53

The entry "2pnwA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 18:53

The entry "2pnwA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 13:12

Retrieved PRC results for job ID SID5197487357437328 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 13:11

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2pnwA01

Flow stage update by auto on 05 Sep 2007 04:26

The entry "2pnwA01" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 04:26

The entry "2pnwA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 13:19

Retrieved HMM(SAM) results for job ID SID3699578550905088 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 13:18

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2pnwA01

Sam cath submit by auto on 04 Sep 2007 10:28

The entry "2pnwA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:28

The entry "2pnwA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 06:26

Retrieved "2pnwA01" CATHEDRAL results for job ID SID4561981892303360 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 06:25

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 315 results for 2pnwA01

Cathedral cath submit by auto on 03 Sep 2007 14:29

The entry "2pnwA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:29

The entry "2pnwA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:45

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pnwA01.scanlist" for "2pnwA01"

Write scan list by auto on 03 Sep 2007 12:45

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pnwA01.scanlist" for domain "2pnwA01"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:33

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:23

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:13

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:16

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:42

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:16

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:33

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:07

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:17

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:12

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:33

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:38

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:17

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:43

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:05

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:24

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:30

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 18:34

Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 28 Aug 2007 18:29

No satisfactory AssignClose result found.

Flow stage update by auto on 28 Aug 2007 18:20

No in_process hits for Domain "2pnwA01" ready to be processed

Flow stage update by auto on 28 Aug 2007 18:20

NW result present for Domain "2pnwA01"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2pnwA01"

Flow stage update by auto on 16 Aug 2007 17:14

Beginning processing for Domain "2pnwA01"

Insertion by cuff on 16 Aug 2007 15:45

nice chopping