CATH Domain: 2pn2A00 XML data for domain: 2pn2A00

Molscript image for 2pn2A00
2pn2A00
PDB coordinates for domain 2pn2A00

PDB 2pn2, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.300 GMP Synthetase; Chain A, domain 3
3.30.300.20 Gene3D
3.30.300.20.12
3.30.300.20.12.1
3.30.300.20.12.1.1
3.30.300.20.12.1.1.1
3.30.300.20.12.1.1.1.1

[top]
Segment boundaries for domain 2pn2A00

Chopping figure for domain 2pn2A00
DomainStart PDB ResidueStop PDB Residue
2pn2A00 -4 132

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.300.20.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2d7vB00 81.62 Vibrio choleraePutative uncharacterized protein 3.30.300.20 151 10 80 2.35 2.91
3gkuA02 74.89 Clostridium symbiosum ATCC 14940Probable RNA-binding protein 3.30.300.120 77 11 52 2.42 4.59
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pn2A00
LYFQGTTSKVTYQGDLRTSAIHLQSNNEIITDAPVDNQGKGEAFSPTDLLATSLASCLTIIGIKARDEIDIAGTTAEVTK
VAADPRRVSEVHIAITFNQELDDKTQKIFYNTALTCPVAKSIHPDIFQKVIIH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pn2A00
XGSDKIHHHHHHENLYFQGXTTSKVTYQGDLRTSAIHLQSNNEIITDAPVDNQGKGEAFSPTDLLATSLASCXLTIIGIK
ARDXEIDIAGTTAEVTKVXAADPRRVSEVHIAITFNQELDDKTQKIFYNTALTCPVAKSIHPDIFQKVIIHSKSY
BLAST against CATH

[top]
Domain History Events (54)

Domain assigned by cuff on 02 Apr 2008 16:13

same superfamily

Domain assignment manual match h by cuff on 02 Apr 2008 16:10

ample evidence for homology

Domain assignment manual match t by tronnberg on 19 Sep 2007 16:45

SSAP: 79.5 OV: 90 SEQ: 10. Similar linkage and structure. The query's function is unknown.

Homcheck review by tronnberg on 19 Sep 2007 16:45

SSAP: 79.5 OV: 90 SEQ: 10. Similar linkage and structure. The query's function is unknown.

Flow stage update by tronnberg on 19 Sep 2007 16:45

SSAP: 79.5 OV: 90 SEQ: 10. Similar linkage and structure. The query's function is unknown.

Homcheck allotment by tronnberg on 19 Sep 2007 16:43

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 19 Sep 2007 16:43

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 21:29

Domain "2pn2A00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 21:28

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pn2A00

Flow stage update by auto on 15 Sep 2007 17:54

Retrieved PRC_PFAMCATH results for job ID SID9574544191400544 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 17:52

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 8 results for 2pn2A00

Update comment by auto on 15 Sep 2007 09:29

PRC_PFAMCATH job SID9574544191400544 is not yet finished.

Prc pfamcath submit by auto on 15 Sep 2007 08:57

The entry "2pn2A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 08:57

The entry "2pn2A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 07:15

Retrieved SSAP results for job ID SID0750020783890208 and results inserted.

Domain scan ssap cath by auto on 15 Sep 2007 07:13

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1361 results for 2pn2A00

Update comment by auto on 09 Sep 2007 23:22

SSAP job SID0750020783890208 is not yet finished.

Flow stage update by auto on 09 Sep 2007 22:42

The entry "2pn2A00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 09 Sep 2007 22:42

The entry "2pn2A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:13

Giving up on SSAP job SID9656478825721344 because submission time of Wed Sep 5 18:52:12 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:13:32 2007).

Update comment by auto on 05 Sep 2007 19:57

SSAP job SID9656478825721344 is not yet finished.

Flow stage update by auto on 05 Sep 2007 18:52

The entry "2pn2A00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 18:52

The entry "2pn2A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 13:03

Retrieved PRC results for job ID SID4475547709664160 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 13:02

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 9 results for 2pn2A00

Prc cath submit by auto on 05 Sep 2007 04:24

The entry "2pn2A00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 04:24

The entry "2pn2A00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 13:10

Retrieved HMM(SAM) results for job ID SID2487059029775072 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 13:09

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 6 results for 2pn2A00

Sam cath submit by auto on 04 Sep 2007 10:26

The entry "2pn2A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:26

The entry "2pn2A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 06:12

Retrieved "2pn2A00" CATHEDRAL results for job ID SID8000116331015712 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 06:10

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 227 results for 2pn2A00

Cathedral cath submit by auto on 03 Sep 2007 14:28

The entry "2pn2A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:28

The entry "2pn2A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:44

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pn2A00.scanlist" for "2pn2A00"

Write scan list by auto on 03 Sep 2007 12:43

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pn2A00.scanlist" for domain "2pn2A00"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:23

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:13

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:16

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Sep 2007 14:13

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Sep 2007 14:05

No in_process hits for Domain "2pn2A00" ready to be processed

Flow stage update by auto on 01 Sep 2007 14:05

NW result present for Domain "2pn2A00"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2pn2A00"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2pn2A00"

Insertion by cuff on 23 Aug 2007 12:58

nice chopping