Domain assigned by cuff on 04 Apr 2008 13:58
same superfamily
CATH Domain: 2pn1A03
2pn1A03
PDB 2pn1, Chain A, Domain 3
Segment boundaries for domain 2pn1A03
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2pn1A01 | 0 | 103 |
| 2pn1A01 | 312 | 330 |
| 2pn1A02 | 104 | 190 |
| 2pn1A03 | 191 | 310 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 3.30.470.20.16.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1vkzA03 | 76.83 | 3.30.470.20 | 129 | 18 | 83 | 3.31 | 3.95 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|2pn1A03 GQELGVDAYVDLISGKVTSIFIKEKLTRAGETDKSRSVLRDDVFELVEHVLDGSGLVGPLDFDLFDVAGTLYLSEINPRF GGGYPHAYECGVNFPAQLYRNLHEINVPQIGQYLDDIY
Domain History Events (68)
Domain assignment manual match h by cuff on 04 Apr 2008 13:56
same superfamily
Domain assignment manual match t by tronnberg on 19 Sep 2007 16:42
SSAP: 76.8 OV: 81 SEQ: 16. Similar linkage and structure. Functionally different.
Homcheck review by tronnberg on 19 Sep 2007 16:42
SSAP: 76.8 OV: 81 SEQ: 16. Similar linkage and structure. Functionally different.
Flow stage update by tronnberg on 19 Sep 2007 16:42
SSAP: 76.8 OV: 81 SEQ: 16. Similar linkage and structure. Functionally different.
Homcheck allotment by tronnberg on 19 Sep 2007 16:38
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 19 Sep 2007 16:38
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 15 Sep 2007 21:34
Domain "2pn1A03" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 15 Sep 2007 21:33
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pn1A03
Flow stage update by auto on 15 Sep 2007 18:00
Retrieved PRC_PFAMCATH results for job ID SID0153916727047104 and results inserted.
Domain scan prc pfamcath by auto on 15 Sep 2007 17:59
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 77 results for 2pn1A03
Update comment by auto on 15 Sep 2007 09:30
PRC_PFAMCATH job SID0153916727047104 is not yet finished.
Flow stage update by auto on 15 Sep 2007 08:58
The entry "2pn1A03" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 15 Sep 2007 08:58
The entry "2pn1A03" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 15 Sep 2007 07:31
Retrieved SSAP results for job ID SID8706264337197096 and results inserted.
Domain scan ssap cath by auto on 15 Sep 2007 07:28
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1935 results for 2pn1A03
Update comment by auto on 09 Sep 2007 23:22
SSAP job SID8706264337197096 is not yet finished.
Ssap cath submit by auto on 09 Sep 2007 22:43
The entry "2pn1A03" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 22:43
The entry "2pn1A03" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 20:14
Giving up on SSAP job SID6056524970754880 because submission time of Wed Sep 5 18:52:48 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:14:04 2007).
Update comment by auto on 05 Sep 2007 19:58
SSAP job SID6056524970754880 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 18:52
The entry "2pn1A03" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 18:52
The entry "2pn1A03" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 13:08
Retrieved PRC results for job ID SID4345639356165596 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 13:07
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 10 results for 2pn1A03
Prc cath submit by auto on 05 Sep 2007 04:25
The entry "2pn1A03" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 04:25
The entry "2pn1A03" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 13:15
Retrieved HMM(SAM) results for job ID SID0991842141330272 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 13:14
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 5 results for 2pn1A03
Sam cath submit by auto on 04 Sep 2007 10:27
The entry "2pn1A03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 10:27
The entry "2pn1A03" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 06:19
Retrieved "2pn1A03" CATHEDRAL results for job ID SID4907876960804880 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 06:18
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 321 results for 2pn1A03
Cathedral cath submit by auto on 03 Sep 2007 14:28
The entry "2pn1A03" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 14:28
The entry "2pn1A03" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 12:44
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pn1A03.scanlist" for "2pn1A03"
Write scan list by auto on 03 Sep 2007 12:44
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pn1A03.scanlist" for domain "2pn1A03"
Update comment by auto on 03 Sep 2007 10:11
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:32
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:37
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:33
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:22
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:23
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:16
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:29
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:13
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:16
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:17
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:42
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:16
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:33
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:07
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 16:17
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 10:12
Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 06:33
Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 02:38
Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 22:17
Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 14:43
Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 09:05
Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 02:24
Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 22:30
Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 18:34
Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 28 Aug 2007 18:29
No satisfactory AssignClose result found.
Flow stage update by auto on 28 Aug 2007 18:20
No in_process hits for Domain "2pn1A03" ready to be processed
Flow stage update by auto on 28 Aug 2007 18:20
NW result present for Domain "2pn1A03"
Flow stage update by auto on 19 Aug 2007 10:12
All required files are present for Domain "2pn1A03"
Flow stage update by auto on 18 Aug 2007 14:31
Beginning processing for Domain "2pn1A03"
Insertion by cuff on 18 Aug 2007 13:26
nice chopping
