CATH Domain: 2pn1A02 XML data for domain: 2pn1A02

Molscript image for 2pn1A02
2pn1A02
PDB coordinates for domain 2pn1A02

PDB 2pn1, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1490 Dna Ligase; domain 1
3.30.1490.20 ATP-grasp fold, A domain Gene3D
3.30.1490.20.13
3.30.1490.20.13.1
3.30.1490.20.13.1.1
3.30.1490.20.13.1.1.1
3.30.1490.20.13.1.1.1.1

Segment boundaries for domain 2pn1A02

Chopping figure for domain 2pn1A02
DomainStart PDB ResidueStop PDB Residue
2pn1A01 0 103
2pn1A01 312 330
2pn1A02 104 190
2pn1A03 191 310

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|2pn1A02
PYAACELCFDKYTYEYCLRQGIAHARTYATASFEEALAAGEVQLPVFVKPRNGDLIVQELLV    

Domain COMBS Sequence

>pdb|2pn1A02
PYAACELCFDKYTXYEYCLRQGIAHARTYATXASFEEALAAGEVQLPVFVKPRNGSASIEVRRVETVEEVEQLFSKNTDL
IVQELLV    

Domain History Events (68)

Domain assigned by cuff on 15 May 2008 15:09

same superfamily

Domain assignment manual match h by cuff on 15 May 2008 15:05

same superfamily

Domain assignment manual match a by tronnberg on 19 Sep 2007 16:38

SSAP: 67.4 OV: 82 SEQ: 3. I am not sure but I think that the query should be assigned to this architecture.

Homcheck review by tronnberg on 19 Sep 2007 16:38

SSAP: 67.4 OV: 82 SEQ: 3. I am not sure but I think that the query should be assigned to this architecture.

Flow stage update by tronnberg on 19 Sep 2007 16:38

SSAP: 67.4 OV: 82 SEQ: 3. I am not sure but I think that the query should be assigned to this architecture.

Homcheck allotment by tronnberg on 19 Sep 2007 16:33

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 19 Sep 2007 16:33

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 21:33

Domain "2pn1A02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 21:32

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pn1A02

Flow stage update by auto on 15 Sep 2007 17:59

Retrieved PRC_PFAMCATH results for job ID SID8796336601196048 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 17:58

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 136 results for 2pn1A02

Update comment by auto on 15 Sep 2007 09:30

PRC_PFAMCATH job SID8796336601196048 is not yet finished.

Prc pfamcath submit by auto on 15 Sep 2007 08:58

The entry "2pn1A02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 08:58

The entry "2pn1A02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 07:28

Retrieved SSAP results for job ID SID4276630991775368 and results inserted.

Domain scan ssap cath by auto on 15 Sep 2007 07:25

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1341 results for 2pn1A02

Update comment by auto on 09 Sep 2007 23:22

SSAP job SID4276630991775368 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:42

The entry "2pn1A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:42

The entry "2pn1A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:13

Giving up on SSAP job SID1463410357971704 because submission time of Wed Sep 5 18:52:40 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:13:58 2007).

Update comment by auto on 05 Sep 2007 19:58

SSAP job SID1463410357971704 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 18:52

The entry "2pn1A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 18:52

The entry "2pn1A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 13:07

Retrieved PRC results for job ID SID9085639560627168 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 13:06

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 11 results for 2pn1A02

Prc cath submit by auto on 05 Sep 2007 04:25

The entry "2pn1A02" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 04:25

The entry "2pn1A02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 13:14

Retrieved HMM(SAM) results for job ID SID2818221007329512 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 13:13

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2pn1A02

Sam cath submit by auto on 04 Sep 2007 10:27

The entry "2pn1A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:27

The entry "2pn1A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 06:18

Retrieved "2pn1A02" CATHEDRAL results for job ID SID9120755289240992 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 06:16

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 285 results for 2pn1A02

Cathedral cath submit by auto on 03 Sep 2007 14:28

The entry "2pn1A02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:28

The entry "2pn1A02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:44

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pn1A02.scanlist" for "2pn1A02"

Write scan list by auto on 03 Sep 2007 12:44

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pn1A02.scanlist" for domain "2pn1A02"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:33

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:23

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:13

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:16

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:42

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:16

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:33

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:07

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:17

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:12

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:33

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:38

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:17

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:43

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:05

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:24

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:30

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 18:34

Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 28 Aug 2007 18:29

No satisfactory AssignClose result found.

Flow stage update by auto on 28 Aug 2007 18:20

No in_process hits for Domain "2pn1A02" ready to be processed

Flow stage update by auto on 28 Aug 2007 18:20

NW result present for Domain "2pn1A02"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2pn1A02"

Flow stage update by auto on 18 Aug 2007 14:31

Beginning processing for Domain "2pn1A02"

Insertion by cuff on 18 Aug 2007 13:26

nice chopping