CATH Domain: 2pn1A01 XML data for domain: 2pn1A01

Molscript image for 2pn1A01
2pn1A01
PDB coordinates for domain 2pn1A01

PDB 2pn1, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.20 Gene3D
3.40.50.20.9
3.40.50.20.9.1
3.40.50.20.9.1.1
3.40.50.20.9.1.1.1
3.40.50.20.9.1.1.1.1

[top]
Segment boundaries for domain 2pn1A01

Chopping figure for domain 2pn1A01
DomainStart PDB ResidueStop PDB Residue
2pn1A01 0 103
2pn1A01 312 330
2pn1A02 104 190
2pn1A03 191 310

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.40.50.20.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1qtqA05 76.02 Aminoacyl-tRNA biosynthesisMetabolic pathwaysGlutaminyl-tRNA synthetaseGlutamine-tRNA ligase activityGlutaminyl-tRNA aminoacylation 3.40.50.620 123 10 69 3.48 4.98
1p3dA01 75.96 D-Glutamine and D-glutamate metabolismUDP-N-acetylmuramate--L-alanine ligaseUDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]Haemophilus influenzaePeptidoglycan biosynthesis 3.40.50.720 87 12 68 3.43 4.98
1bxrA05 75.71 3.40.50.20 140 13 65 2.82 4.34
1jflA02 75.62 Aspartate racemase [EC:5.1.1.13]228aa long hypothetical aspartate racemasePyrococcus horikoshiiAlanine, aspartate and glutamate metabolism 3.40.50.1860 109 9 72 3.58 4.95
2x5oA01 75.23 D-Glutamine and D-glutamate metabolismPeptidoglycan biosynthesisMetabolic pathwaysUDP-N-acetylmuramoylalanine--D-glutamate ligaseUDP-N-acetylmuramoylalanine-D-glutamate ligase activity 3.40.50.720 92 9 71 3.30 4.62
2dwuA02 75.07 D-Glutamine and D-glutamate metabolismMetabolic pathwaysBacillus anthracisGlutamate racemaseGlutamate racemase [EC:5.1.1.3] 3.40.50.1860 113 9 71 3.01 4.21
1iowA01 73.60 D-Alanine metabolismPeptidoglycan biosynthesisD-alanine--D-alanine ligase BD-alanine-D-alanine ligase [EC:6.3.2.4]Escherichia coli K-12 3.40.50.20 84 10 59 2.86 4.79
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pn1A01
GQKPHLLITSAGRRAKLVEYFVKEFKTGRVSTADCSPLASALYADQHYIVPKIDEVEYIDHLLTLCQDEGVTALLTLIDP
ELGLLAQATERFQAIGVTVIVSLKHDTVTLISAAELQKIKR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pn1A01
GXQKPHLLITSAGRRAKLVEYFVKEFKTGRVSTADCSPLASALYXADQHYIVPKIDEVEYIDHLLTLCQDEGVTALLTLI
DPELGLLAQATERFQAIGVTVIVSLKHDTVTLISAAELQKIKR
BLAST against CATH

[top]
Domain History Events (68)

Domain assigned by cuff on 04 Apr 2008 14:58

same superfamily

Domain assignment manual match h by cuff on 04 Apr 2008 14:57

same function, nice structural match

Domain assignment manual match t by tronnberg on 19 Sep 2007 16:32

SSAP: 80.3 OV: 76 SEQ: 18. Similar linkage and structure (only differ with a side linkage). Functionally different. None of the matches with a assaigned CATH code and a SSAP score of at least 75 has the same function as the query.

Homcheck review by tronnberg on 19 Sep 2007 16:32

SSAP: 80.3 OV: 76 SEQ: 18. Similar linkage and structure (only differ with a side linkage). Functionally different. None of the matches with a assaigned CATH code and a SSAP score of at least 75 has the same function as the query.

Flow stage update by tronnberg on 19 Sep 2007 16:32

SSAP: 80.3 OV: 76 SEQ: 18. Similar linkage and structure (only differ with a side linkage). Functionally different. None of the matches with a assaigned CATH code and a SSAP score of at least 75 has the same function as the query.

Homcheck allotment by tronnberg on 19 Sep 2007 16:24

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 19 Sep 2007 16:24

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 21:32

Domain "2pn1A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 21:31

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pn1A01

Flow stage update by auto on 15 Sep 2007 17:57

Retrieved PRC_PFAMCATH results for job ID SID9112677754933890 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 17:56

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 379 results for 2pn1A01

Update comment by auto on 15 Sep 2007 09:30

PRC_PFAMCATH job SID9112677754933890 is not yet finished.

Prc pfamcath submit by auto on 15 Sep 2007 08:58

The entry "2pn1A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 08:58

The entry "2pn1A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 07:25

Retrieved SSAP results for job ID SID2056833116807120 and results inserted.

Domain scan ssap cath by auto on 15 Sep 2007 07:21

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2273 results for 2pn1A01

Update comment by auto on 09 Sep 2007 23:22

SSAP job SID2056833116807120 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:42

The entry "2pn1A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:42

The entry "2pn1A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:13

Giving up on SSAP job SID0265094053039714 because submission time of Wed Sep 5 18:52:33 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:13:51 2007).

Update comment by auto on 05 Sep 2007 19:58

SSAP job SID0265094053039714 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 18:52

The entry "2pn1A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 18:52

The entry "2pn1A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 13:06

Retrieved PRC results for job ID SID9294744846788560 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 13:05

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 5 results for 2pn1A01

Prc cath submit by auto on 05 Sep 2007 04:24

The entry "2pn1A01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 04:24

The entry "2pn1A01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 13:13

Retrieved HMM(SAM) results for job ID SID0664584632462912 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 13:12

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2pn1A01

Flow stage update by auto on 04 Sep 2007 10:27

The entry "2pn1A01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Sep 2007 10:27

The entry "2pn1A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 06:16

Retrieved "2pn1A01" CATHEDRAL results for job ID SID5590741307035200 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 06:14

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 467 results for 2pn1A01

Flow stage update by auto on 03 Sep 2007 14:28

The entry "2pn1A01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Sep 2007 14:28

The entry "2pn1A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:44

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pn1A01.scanlist" for "2pn1A01"

Write scan list by auto on 03 Sep 2007 12:44

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pn1A01.scanlist" for domain "2pn1A01"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:33

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:23

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:13

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:16

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:42

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:16

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:33

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:07

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:17

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:12

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:33

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:38

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:17

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:43

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:05

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:24

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:30

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 18:34

Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 28 Aug 2007 18:29

No satisfactory AssignClose result found.

Flow stage update by auto on 28 Aug 2007 18:20

No in_process hits for Domain "2pn1A01" ready to be processed

Flow stage update by auto on 28 Aug 2007 18:20

NW result present for Domain "2pn1A01"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2pn1A01"

Flow stage update by auto on 18 Aug 2007 14:31

Beginning processing for Domain "2pn1A01"

Insertion by cuff on 18 Aug 2007 13:26

nice chopping