CATH Domain: 2pmqA01 XML data for domain: 2pmqA01

Molscript image for 2pmqA01
2pmqA01
PDB coordinates for domain 2pmqA01

PDB 2pmq, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.10 Enolase-like, N-terminal domain Gene3D
3.30.390.10.6
3.30.390.10.6.1
3.30.390.10.6.1.1
3.30.390.10.6.1.1.1
3.30.390.10.6.1.1.1.1

[top]
Segment boundaries for domain 2pmqA01

Chopping figure for domain 2pmqA01
DomainStart PDB ResidueStop PDB Residue
2pmqA01 2 116
2pmqA01 351 364
2pmqA02 117 350

Structural Neighbourhood (24 entries)

There are 24 matching structural neighberhood comparisons for CATH ID 3.30.390.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 24 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3fv9D01 91.48 Mandelate racemase/muconate lactonizing enzyme, putativeRoseovarius nubinhibens ISM 3.30.390.10 130 39 93 1.27 1.36
1nu5A01 88.66 Chloromuconate cycloisomerasePseudomonas sp. P51 3.30.390.10 116 29 86 1.86 2.15
3dgbA01 88.58 Muconate cycloisomeraseToluene and xylene degradationMuconate cycloisomerase [EC:5.5.1.1]Benzoate degradation via hydroxylationMetabolic pathways 3.30.390.10 134 29 94 2.21 2.35
2ovlA01 87.87 Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase 3.30.390.10 123 23 90 2.57 2.84
1tkkA01 87.37 Bacillus subtilisL-Ala-D/L-Glu epimerase 3.30.390.10 115 26 85 1.71 1.99
2og9A01 86.80 Toluene and xylene degradationPolaromonas sp. JS666Mandelate racemase [EC:5.1.2.2]Mandelate racemase/muconate lactonizing enzymeBenzoate degradation via hydroxylation 3.30.390.10 129 17 83 3.40 4.06
3go2A01 86.41 Burkholderia xenovorans LB400Putative uncharacterized protein 3.30.390.10 114 19 82 2.54 3.07
1mdlA01 85.56 Mandelate racemasePseudomonas putida 3.30.390.10 126 16 91 3.20 3.50
2zadA01 85.53 Thermotoga maritimaL-Ala-D/L-Glu epimerase 3.30.390.10 109 21 84 2.12 2.52
3bjsA01 85.51 Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme 3.30.390.10 116 19 81 2.05 2.50
1ec7C01 85.10 Ascorbate and aldarate metabolismD-glucarate catabolic processGlucarate dehydratase activityGlucarate dehydrataseGlucarate dehydratase [EC:4.2.1.40] 3.30.390.10 136 19 85 2.60 3.05
2qq6B01 84.80 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein 3.30.390.10 115 21 80 3.10 3.86
1jpdX01 84.70 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.30.390.10 99 19 77 2.22 2.88
2oqyA01 83.95 Muconate cycloisomeraseOceanobacillus iheyensis 3.30.390.10 142 22 81 3.04 3.72
2qjjA01 83.87 Mandelate racemase/muconate lactonizing enzyme, N-terminal domain proteinStarvation sensing protein RspANovosphingobium aromaticivorans DSM 12444 3.30.390.10 140 19 76 2.74 3.59
2qgyB01 83.87 3.30.390.10 135 21 82 3.01 3.63
1tzzB01 83.24 Bradyrhizobium japonicumBll6730 protein 3.30.390.10 119 14 74 2.29 3.09
2pgwA01 82.84 Sinorhizobium melilotiToluene and xylene degradationBenzoate degradation via hydroxylationMuconate cycloisomerase [EC:5.5.1.1]Mandelate racemase/muconate lactonizing enzyme family protein 3.30.390.10 147 25 80 2.92 3.64
1rvkA01 82.58 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.30.390.10 115 15 77 2.93 3.76
2nqlA01 81.82 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.30.390.10 162 24 73 2.92 3.98
2hzgB01 81.53 Rhodobacter sphaeroides 2.4.1Mandelate racemase/muconate lactonizing enzyme/Enolase superfamily 3.30.390.10 143 21 74 3.14 4.20
2oz8A01 81.22 Mesorhizobium lotiMll7089 protein 3.30.390.10 128 12 88 4.31 4.88
3cawA01 78.13 Ubiquinone and other terpenoid-quinone biosynthesisO-succinylbenzoate synthase [EC:4.2.1.113]Bdellovibrio bacteriovorusMetabolic pathwaysPutative uncharacterized protein 3.30.390.10 91 15 71 3.30 4.61
1stzA03 72.86 Thermotoga maritimaHeat-inducible transcription repressor hrcAHeat-inducible transcriptional repressor 3.30.390.60 89 13 64 3.18 4.93
[1]
Displaying entries 1 to 24 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pmqA01
KIAEIQLFQHDLPVVNGPYRIASGDVWSLTTTIVKIIAEDGTIGWGETCPVGPTYAEAHAGGALAALEVLASGLAGAEAL
PLPLHTRDSLLCGHNYAKSALDIAVHDLWGKRLGLGLTIDPERFGPPL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pmqA01
XSLKIAEIQLFQHDLPVVNGPYRIASGDVWSLTTTIVKIIAEDGTIGWGETCPVGPTYAEAHAGGALAALEVLASGLAGA
EALPLPLHTRXDSLLCGHNYAKSALDIAVHDLWGKRLGLGLTIDPERFGPPL
BLAST against CATH

[top]
Domain History Events (17)

Domain assigned by auto on 02 Apr 2008 11:48

Assigning to "3.30.390.10" based on similarity with "2pceA01"

Flow stage update by auto on 02 Apr 2008 11:47

No in_process hits for Domain "2pmqA01" ready to be processed

Update comment by auto on 02 Apr 2008 11:45

Domain "2pmqA01" hits Domain "2pceD01" (41.6666666666667% over 92.3076923076923%) which is currently in process

Update comment by auto on 02 Apr 2008 11:43

Domain "2pmqA01" hits Domain "2pceB01" (41.6666666666667% over 92.3076923076923%) which is currently in process

Update comment by auto on 02 Apr 2008 11:41

Domain "2pmqA01" hits Domain "2pceG01" (41.6666666666667% over 92.3076923076923%) which is currently in process

Update comment by auto on 02 Apr 2008 11:39

Domain "2pmqA01" hits Domain "2pceF01" (41.6666666666667% over 92.3076923076923%) which is currently in process

Update comment by auto on 02 Apr 2008 11:37

Domain "2pmqA01" hits Domain "2pceH01" (41.6666666666667% over 92.3076923076923%) which is currently in process

Update comment by auto on 02 Apr 2008 11:33

Domain "2pmqA01" hits Domain "2pceA01" (41.6666666666667% over 92.3076923076923%) which is currently in process

Update comment by auto on 02 Apr 2008 11:30

Domain "2pmqA01" hits Domain "2pceE01" (41.6666666666667% over 92.3076923076923%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2pmqA01" hits Domain "2pceC01" (41.6666666666667% over 92.3076923076923%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2pmqA01" hits Domain "2pceC01" (41.6666666666667% over 92.3076923076923%) which is currently in process

Update comment by auto on 01 Sep 2007 14:06

Domain "2pmqA01" hits Domain "2pceC01" (41.6666666666667% over 92.3076923076923%) which is currently in process

Flow stage update by auto on 01 Sep 2007 14:05

Domain "2pmqA01" hits Domain "2pceC01" (41.6666666666667% over 92.3076923076923%) which is currently in process

Flow stage update by auto on 01 Sep 2007 14:05

NW result present for Domain "2pmqA01"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2pmqA01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2pmqA01"

Insertion by auto on 23 Aug 2007 14:12

Final ChopClose added based on similarity with "2pmqB"