CATH Domain: 2pmaA01 XML data for domain: 2pmaA01

Molscript image for 2pmaA01
2pmaA01
PDB coordinates for domain 2pmaA01

PDB 2pma, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.70 Cathepsin D, subunit A; domain 1
2.40.70.10 Acid Proteases Gene3D
2.40.70.10.11
2.40.70.10.11.1
2.40.70.10.11.1.1
2.40.70.10.11.1.1.1
2.40.70.10.11.1.1.1.1

[top]
Segment boundaries for domain 2pmaA01

Chopping figure for domain 2pmaA01
DomainStart PDB ResidueStop PDB Residue
2pmaA01 23 158

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 2.40.70.10.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2hahA00 81.00 Pol polyproteinFeline immunodeficiency virus (isolate Petaluma) 2.40.70.10 112 12 79 2.88 3.62
1fmbA00 79.75 Equine infectious anemia virus (clone CL22)Pol polyprotein 2.40.70.10 104 16 79 3.42 4.30
2rspA00 79.35 Rous sarcoma virus - Prague CGag polyprotein 2.40.70.10 115 9 72 3.00 4.13
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pmaA01
SNAIYGYVEKATLIDQNLTLSAKLDTGAKSASLHAVNITEIEKKGIPYLRFTVPTKTGDYSFEGEYVGKVKIPIKRPVVL
LNIKLGDKVRTIKVNLTNRKRFLYPLLLGRDAIIDFNGAVD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pmaA01
SNAIYGYVEKATLIDQNLTLSAKLDTGAKSASLHAVNITEIEKKGIPYLRFTVPTKTGDYSFEGEYVGKVKIKVRSSETN
PGLLRTTPIKRPVVLLNIKLGDKVRTIKVNLTNRKRFLYPLLLGRDAIIDFNGAVD
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 04 Apr 2008 17:19

Assigning to "2.40.70.10" based on similarity with "2pmaB01"

Flow stage update by auto on 04 Apr 2008 17:08

No in_process hits for Domain "2pmaA01" ready to be processed

Update comment by auto on 03 Sep 2007 20:10

Domain "2pmaA01" hits Domain "2pmaB01" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2pmaA01" hits Domain "2pmaB01" (100% over 100%) which is currently in process

Update comment by auto on 28 Aug 2007 18:21

Domain "2pmaA01" hits Domain "2pmaB01" (100% over 100%) which is currently in process

Flow stage update by auto on 28 Aug 2007 18:20

Domain "2pmaA01" hits Domain "2pmaB01" (100% over 100%) which is currently in process

Flow stage update by auto on 28 Aug 2007 18:20

NW result present for Domain "2pmaA01"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2pmaA01"

Flow stage update by auto on 16 Aug 2007 17:14

Beginning processing for Domain "2pmaA01"

Insertion by auto on 16 Aug 2007 16:08

Final ChopClose added based on similarity with "2pmaB"