CATH Domain: 2pkhB01 XML data for domain: 2pkhB01

Molscript image for 2pkhB01
2pkhB01
PDB coordinates for domain 2pkhB01

PDB 2pkh, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1410 Chorismate lyase
3.40.1410.10 Chorismate lyase Gene3D
3.40.1410.10.9
3.40.1410.10.9.1
3.40.1410.10.9.1.1
3.40.1410.10.9.1.1.1
3.40.1410.10.9.1.1.1.1

[top]
Segment boundaries for domain 2pkhB01

Chopping figure for domain 2pkhB01
DomainStart PDB ResidueStop PDB Residue
2pkhB01 108 238

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.40.1410.10.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2p19A01 90.10 Corynebacterium glutamicumBacterial regulatory proteins, gntR family 3.40.1410.10 130 21 96 1.53 1.58
3ddvB01 88.92 GntR family transcriptional regulatorTranscriptional regulator, GntR familyEnterococcus faecalis 3.40.1410.10 137 16 90 1.79 1.98
2oggA01 87.92 GntR family transcriptional regulator, trehalose operon transcriptional repressorBacillus subtilisTrehalose operon transcriptional repressor 3.40.1410.10 133 10 93 1.93 2.05
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pkhB01
HRHTCKVVLKEEAAGSERALALDREGQRVFHSLIVHFENDIPVQIEDRFVNAQVAPDYLKQDFTLQTPYAYLSQVAPLTE
GEHVVEAILAEADECKLLQIDAGEPCLLIRRRTWSGRQPVTAARLIHPG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pkhB01
SNAARGHRHTCKVXVLKEEAAGSERALALDXREGQRVFHSLIVHFENDIPVQIEDRFVNAQVAPDYLKQDFTLQTPYAYL
SQVAPLTEGEHVVEAILAEADECKLLQIDAGEPCLLIRRRTWSGRQPVTAARLIHPG
BLAST against CATH

[top]
Domain History Events (15)

Domain assigned by auto on 03 Apr 2008 17:48

Assigning to "3.40.1410.10" based on similarity with "2pkhE01"

Flow stage update by auto on 03 Apr 2008 17:33

No in_process hits for Domain "2pkhB01" ready to be processed

Update comment by auto on 03 Apr 2008 17:18

Domain "2pkhB01" hits Domain "2pkhG01" (98.5401459854015% over 100%) which is currently in process

Update comment by auto on 03 Apr 2008 17:02

Domain "2pkhB01" hits Domain "2pkhH01" (98.5401459854015% over 100%) which is currently in process

Update comment by auto on 03 Apr 2008 16:46

Domain "2pkhB01" hits Domain "2pkhA01" (98.5401459854015% over 100%) which is currently in process

Update comment by auto on 03 Apr 2008 16:31

Domain "2pkhB01" hits Domain "2pkhC01" (98.5401459854015% over 100%) which is currently in process

Update comment by auto on 03 Apr 2008 16:15

Domain "2pkhB01" hits Domain "2pkhE01" (98.5401459854015% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2pkhB01" hits Domain "2pkhF01" (98.5401459854015% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2pkhB01" hits Domain "2pkhF01" (98.5401459854015% over 100%) which is currently in process

Update comment by auto on 28 Aug 2007 14:06

Domain "2pkhB01" hits Domain "2pkhF01" (98.5401459854015% over 100%) which is currently in process

Flow stage update by auto on 28 Aug 2007 14:05

Domain "2pkhB01" hits Domain "2pkhF01" (98.5401459854015% over 100%) which is currently in process

Flow stage update by auto on 28 Aug 2007 14:05

NW result present for Domain "2pkhB01"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2pkhB01"

Flow stage update by auto on 16 Aug 2007 17:14

Beginning processing for Domain "2pkhB01"

Insertion by auto on 16 Aug 2007 16:46

Final ChopClose added based on similarity with "2pkhA"