CATH Domain: 2pkeA01 XML data for domain: 2pkeA01

Molscript image for 2pkeA01
2pkeA01
PDB coordinates for domain 2pkeA01

PDB 2pke, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1000 Gene3D
3.40.50.1000.22
3.40.50.1000.22.1
3.40.50.1000.22.1.1
3.40.50.1000.22.1.1.1
3.40.50.1000.22.1.1.1.1

Segment boundaries for domain 2pkeA01

Chopping figure for domain 2pkeA01
DomainStart PDB ResidueStop PDB Residue
2pkeA01 0 26
2pkeA01 110 249
2pkeA02 27 109

Structural Neighbourhood (29 entries)

There are 29 matching structural neighberhood comparisons for CATH ID 3.40.50.1000.22.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 29 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2nyvA01 86.99 Phosphoglycolate phosphatase [EC:3.1.3.18]Glyoxylate and dicarboxylate metabolismMetabolic pathwaysAquifex aeolicusPhosphoglycolate phosphatase 3.40.50.1000 151 13 91 3.45 3.77
2hszA01 86.82 Phosphoglycolate phosphatase [EC:3.1.3.18]Haemophilus somnus 129PTMetabolic pathwaysGlyoxylate and dicarboxylate metabolismPhosphoglycolate phosphatase 3.40.50.1000 148 18 87 2.22 2.54
2ah5A01 86.67 Glyoxylate and dicarboxylate metabolismMetabolic pathwaysPhosphoglycolate phosphatase [EC:3.1.3.18]Hydrolase, haloacid dehalogenase-like familyStreptococcus pneumoniae 3.40.50.1000 142 14 84 2.02 2.38
2fdrA01 86.34 Agrobacterium tumefaciens str. C58Putative uncharacterized protein 3.40.50.1000 150 18 84 3.62 4.27
3ed5A01 86.32 Putative HAD-hydrolase yfnBBacillus subtilis2-haloacid dehalogenase [EC:3.8.1.2]1,2-Dichloroethane degradationGamma-Hexachlorocyclohexane degradation 3.40.50.1000 140 18 85 3.39 3.96
1te2A01 84.53 Fructose and mannose metabolismMetabolic pathwaysRiboflavin metabolismThiamine metabolismMetal ion binding 3.40.50.1000 141 19 82 2.19 2.64
2fi1A01 84.23 Hydrolase, haloacid dehalogenase-like familyStreptococcus pneumoniae 3.40.50.1000 123 13 76 2.13 2.79
2p11A01 84.07 Burkholderia xenovorans LB400Putative uncharacterized protein 3.40.50.1000 140 21 82 3.18 3.84
2ho4B01 83.96 Mus musculusHaloacid dehalogenase-like hydrolase domain-containing protein 2 3.40.50.1000 159 15 83 2.52 3.01
3e58B01 83.80 Streptococcus thermophilus LMG 18311Beta-phosphoglucomutase, putative 3.40.50.1000 136 12 83 3.07 3.67
3d6jA01 83.80 Phosphoglycolate phosphatase [EC:3.1.3.18]Putative haloacid dehalogenase-like hydrolaseBacteroides fragilis NCTC 9343Glyoxylate and dicarboxylate metabolismMetabolic pathways 3.40.50.1000 137 15 82 2.46 2.99
2hdoA01 83.50 Phosphoglycolate phosphatase [EC:3.1.3.18]Lactobacillus plantarumMetabolic pathwaysGlyoxylate and dicarboxylate metabolismPhosphoglycolate phosphatase (Putative) 3.40.50.1000 134 16 81 3.52 4.31
3i28A01 82.93 PeroxisomeSoluble epoxide hydrolase [EC:3.3.2.10]Arachidonic acid metabolismEpoxide hydrolase activityEpoxide hydrolase 2 3.40.50.1000 135 13 79 2.96 3.72
3cnhA01 82.37 Hydrolase family proteinPutative hydrolase of the HAD superfamilyDeinococcus radiodurans 3.40.50.1000 114 18 72 1.86 2.57
1swvA01 82.12 Bacillus cereusPhosphonoacetaldehyde hydrolase 3.40.50.1000 178 12 74 2.46 3.29
2b0cA01 82.05 Phosphatase yihXGlucose-1-phosphatase activityPutative hydrolase of the HAD superfamilyEscherichia coli K-12 3.40.50.1000 133 16 78 2.96 3.75
1zjjB01 82.05 4-nitrophenyl phosphatase [EC:3.1.3.41]Pyrococcus horikoshiiGamma-Hexachlorocyclohexane degradationPutative uncharacterized protein PH1952 3.40.50.1000 146 16 85 3.25 3.80
3bwvA01 81.00 Putative 5'(3')-deoxyribonucleotidaseStaphylococcus epidermidis ATCC 12228 3.40.50.1000 121 15 77 3.44 4.43
1cqzA01 80.59 PeroxisomeMus musculusSoluble epoxide hydrolase [EC:3.3.2.10]Arachidonic acid metabolismEpoxide hydrolase 2 3.40.50.1000 162 13 76 3.01 3.93
1nf2A01 80.54 Thermotoga maritimaPutative uncharacterized protein 3.40.50.1000 161 11 84 4.09 4.84
2i6xA01 80.41 Hydrolase, haloacid dehalogenase-like familyPutative hydrolase of the HAD superfamilyPorphyromonas gingivalis 3.40.50.1000 127 11 77 2.49 3.21
1wpgA04 80.24 Calcium ion bindingATP catabolic processER-Golgi intermediate compartmentCalcium-transporting ATPase activitySarcoplasmic/endoplasmic reticulum calcium ATPase 1 3.40.50.1000 156 12 77 3.58 4.62
3fvvA01 79.07 Bordetella pertussisPutative uncharacterized protein 3.40.50.1000 148 12 76 2.92 3.79
3b8cA03 75.98 Oxidative phosphorylationArabidopsis thalianaPlasma membraneATPase 2, plasma membrane-typeProtein binding 3.40.50.1000 163 11 76 3.51 4.61
2rjnA00 75.58 Response regulator receiver:Metal-dependent phosphohydrolase, HD subdomainNeptuniibacter caesariensis 3.40.50.2300 135 8 67 3.32 4.90
1ny5A01 75.05 Transcriptional regulator (NtrC family)Two-component system, NtrC family, response regulatorAquifex aeolicus 3.40.50.2300 136 8 66 3.32 5.00
1iirA02 74.89 Glycosyltransferase GtfBAmycolatopsis orientalis 3.40.50.2000 161 12 74 3.16 4.24
3beoA02 74.23 Amino sugar and nucleotide sugar metabolismMetabolic pathwaysBacillus anthracisUDP-N-acetylglucosamine 2-epimerase [EC:5.1.3.14]UDP-N-acetylglucosamine 2-epimerase 3.40.50.2000 161 10 80 3.63 4.50
2qv0A00 73.98 Protein mrkEKlebsiella pneumoniae 3.40.50.2300 122 6 65 3.10 4.76
Displaying entries 1 to 29 (page 1 of 1)


Domain ATOM Sequence

>pdb|2pkeA01
GTPIAQRDGQAIQLVGFDGDDTLWKSVEVIAGVREAVAAIAADYAVVLITKGDLFHQEQKIEQSGLSDLFPRIEVVSEKD
PQTYARVLSEFDLPAERFVIGNSLRSDVEPVLAIGGWGIYTPYADEPRLREVPDPSGWPAAVRALDAQAGRQ    

Domain COMBS Sequence

>pdb|2pkeA01
GXTPIAQRDGQAIQLVGFDGDDTLWKSVEVIAGVREAVAAIAADYAVVLITKGDLFHQEQKIEQSGLSDLFPRIEVVSEK
DPQTYARVLSEFDLPAERFVXIGNSLRSDVEPVLAIGGWGIYTPYAVTWAHEQDHGVAADEPRLREVPDPSGWPAAVRAL
DAQAGRQ    

Domain History Events (53)

Domain assigned by cuff on 14 Feb 2008 19:00

i agree - same superfamily

Domain assignment manual match h by tronnberg on 19 Sep 2007 15:40

SSAP: 84.3 OV: 78 SEQ: 16. Similar linkage and reasonable similar structure (differ with two alfa helices). Similar functions. The match is a L-2-haloacid dehalogenase, and the query is a Haloacid delahogenase-like family hydrolase.

Homcheck review by tronnberg on 19 Sep 2007 15:40

SSAP: 84.3 OV: 78 SEQ: 16. Similar linkage and reasonable similar structure (differ with two alfa helices). Similar functions. The match is a L-2-haloacid dehalogenase, and the query is a Haloacid delahogenase-like family hydrolase.

Flow stage update by tronnberg on 19 Sep 2007 15:40

SSAP: 84.3 OV: 78 SEQ: 16. Similar linkage and reasonable similar structure (differ with two alfa helices). Similar functions. The match is a L-2-haloacid dehalogenase, and the query is a Haloacid delahogenase-like family hydrolase.

Homcheck allotment by tronnberg on 19 Sep 2007 15:26

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 19 Sep 2007 15:26

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 21:20

Domain "2pkeA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 21:19

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pkeA01

Flow stage update by auto on 15 Sep 2007 17:44

Retrieved PRC_PFAMCATH results for job ID SID8862248586708572 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 17:43

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 164 results for 2pkeA01

Update comment by auto on 15 Sep 2007 09:28

PRC_PFAMCATH job SID8862248586708572 is not yet finished.

Flow stage update by auto on 15 Sep 2007 08:56

The entry "2pkeA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 15 Sep 2007 08:56

The entry "2pkeA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 06:56

Retrieved SSAP results for job ID SID3822092311480768 and results inserted.

Domain scan ssap cath by auto on 15 Sep 2007 06:54

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1908 results for 2pkeA01

Update comment by auto on 09 Sep 2007 23:21

SSAP job SID3822092311480768 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:41

The entry "2pkeA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:41

The entry "2pkeA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:12

Giving up on SSAP job SID7422073237904552 because submission time of Wed Sep 5 18:51:02 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:12:27 2007).

Update comment by auto on 05 Sep 2007 19:56

SSAP job SID7422073237904552 is not yet finished.

Flow stage update by auto on 05 Sep 2007 18:51

The entry "2pkeA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 18:51

The entry "2pkeA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 12:52

Retrieved PRC results for job ID SID4034521577509264 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 12:51

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 46 results for 2pkeA01

Prc cath submit by auto on 05 Sep 2007 04:22

The entry "2pkeA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 04:22

The entry "2pkeA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 12:59

Retrieved HMM(SAM) results for job ID SID6338180372628276 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 12:58

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 30 results for 2pkeA01

Sam cath submit by auto on 04 Sep 2007 10:25

The entry "2pkeA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:25

The entry "2pkeA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 05:59

Retrieved "2pkeA01" CATHEDRAL results for job ID SID1857896474033720 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 05:58

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 449 results for 2pkeA01

Flow stage update by auto on 03 Sep 2007 14:27

The entry "2pkeA01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Sep 2007 14:27

The entry "2pkeA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:42

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pkeA01.scanlist" for "2pkeA01"

Write scan list by auto on 03 Sep 2007 12:42

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pkeA01.scanlist" for domain "2pkeA01"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:22

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:13

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:15

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Sep 2007 14:13

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Sep 2007 14:05

No in_process hits for Domain "2pkeA01" ready to be processed

Flow stage update by auto on 01 Sep 2007 14:05

NW result present for Domain "2pkeA01"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2pkeA01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2pkeA01"

Insertion by cuff on 23 Aug 2007 12:58

nice chopping