Domain assigned by cuff on 14 Feb 2008 19:00
i agree - same superfamily
| CATH Code | Level Description | Links |
|---|---|---|
3
| Alpha Beta | |
3.40
| 3-Layer(aba) Sandwich | |
3.40.50
| Rossmann fold | |
3.40.50.1000
| Gene3D | |
3.40.50.1000.22
| ||
3.40.50.1000.22.1
| ||
3.40.50.1000.22.1.1
| ||
3.40.50.1000.22.1.1.1
| ||
3.40.50.1000.22.1.1.1.1
|
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2pkeA01 | 0 | 26 |
| 2pkeA01 | 110 | 249 |
| 2pkeA02 | 27 | 109 |
There are 29 matching structural neighberhood comparisons for CATH ID 3.40.50.1000.22.1.1.1.1 (SIMAX score < 5)
>pdb|2pkeA01 GTPIAQRDGQAIQLVGFDGDDTLWKSVEVIAGVREAVAAIAADYAVVLITKGDLFHQEQKIEQSGLSDLFPRIEVVSEKD PQTYARVLSEFDLPAERFVIGNSLRSDVEPVLAIGGWGIYTPYADEPRLREVPDPSGWPAAVRALDAQAGRQ
i agree - same superfamily
SSAP: 84.3 OV: 78 SEQ: 16. Similar linkage and reasonable similar structure (differ with two alfa helices). Similar functions. The match is a L-2-haloacid dehalogenase, and the query is a Haloacid delahogenase-like family hydrolase.
SSAP: 84.3 OV: 78 SEQ: 16. Similar linkage and reasonable similar structure (differ with two alfa helices). Similar functions. The match is a L-2-haloacid dehalogenase, and the query is a Haloacid delahogenase-like family hydrolase.
SSAP: 84.3 OV: 78 SEQ: 16. Similar linkage and reasonable similar structure (differ with two alfa helices). Similar functions. The match is a L-2-haloacid dehalogenase, and the query is a Haloacid delahogenase-like family hydrolase.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2pkeA01" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pkeA01
Retrieved PRC_PFAMCATH results for job ID SID8862248586708572 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 164 results for 2pkeA01
PRC_PFAMCATH job SID8862248586708572 is not yet finished.
The entry "2pkeA01" has been submitted to the PRC_PFAMCATH webservice.
The entry "2pkeA01" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID3822092311480768 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1908 results for 2pkeA01
SSAP job SID3822092311480768 is not yet finished.
The entry "2pkeA01" has been submitted to the SSAP webservice.
The entry "2pkeA01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID7422073237904552 because submission time of Wed Sep 5 18:51:02 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:12:27 2007).
SSAP job SID7422073237904552 is not yet finished.
The entry "2pkeA01" has been submitted to the SSAP webservice.
The entry "2pkeA01" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID4034521577509264 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 46 results for 2pkeA01
The entry "2pkeA01" has been submitted to the PRC webservice.
The entry "2pkeA01" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID6338180372628276 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 30 results for 2pkeA01
The entry "2pkeA01" has been submitted to the HMM (SAM) webservice.
The entry "2pkeA01" has been submitted to the HMM (SAM) webservice.
Retrieved "2pkeA01" CATHEDRAL results for job ID SID1857896474033720 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 449 results for 2pkeA01
The entry "2pkeA01" has been submitted to the CATHEDRAL webservice.
The entry "2pkeA01" has been submitted to the CATHEDRAL webservice.
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pkeA01.scanlist" for "2pkeA01"
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pkeA01.scanlist" for domain "2pkeA01"
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2pkeA01" ready to be processed
NW result present for Domain "2pkeA01"
All required files are present for Domain "2pkeA01"
Beginning processing for Domain "2pkeA01"
nice chopping