CATH Domain: 2pjuD03 XML data for domain: 2pjuD03

Molscript image for 2pjuD03
2pjuD03
PDB coordinates for domain 2pjuD03

PDB 2pju, Chain D, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.5 Single alpha-helices involved in coiled-coils or other helix-helix interfaces
1.20.5.170 Gene3D
1.20.5.170.12
1.20.5.170.12.1
1.20.5.170.12.1.1
1.20.5.170.12.1.1.1
1.20.5.170.12.1.1.1.1

[top]
Segment boundaries for domain 2pjuD03

Chopping figure for domain 2pjuD03
DomainStart PDB ResidueStop PDB Residue
2pjuD01 11 88
2pjuD02 89 177
2pjuD03 178 223

Structural Neighbourhood (63 entries)

There are 63 matching structural neighberhood comparisons for CATH ID 1.20.5.170.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 63 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2p7jB01 85.25 Vibrio parahaemolyticusPutative sensory box/GGDEF family protein 1.20.5.170 39 7 75 3.33 4.40
1a2xB00 84.63 Troponin I, fast skeletal muscleTroponin T bindingOryctolagus cuniculus 1.20.5.420 31 6 65 1.00 1.52
2v7qJ00 84.15 Protein homodimerization activityNegative regulation of hydrolase activityATPase inhibitor activityBos taurusCalmodulin binding 1.20.5.500 43 7 69 2.46 3.53
1hf9A00 83.28 Protein homodimerization activityNegative regulation of hydrolase activityATPase inhibitor activityBos taurusATPase binding 1.20.5.500 41 7 65 1.21 1.84
2r44A01 82.94 Cytophaga hutchinsonii ATCC 33406MoxR-like ATPase [EC:3.6.3.-]Putative uncharacterized protein 1.20.5.420 26 7 63 1.65 2.60
1junA00 82.47 Pathways in cancerChagas diseaseNeurotrophin signaling pathwayB cell receptor signaling pathwayT cell receptor signaling pathway 1.20.5.170 43 4 65 1.51 2.32
1kilE00 81.95 Complexin-1Syntaxin-1 bindingRattus norvegicusDendriteSynaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complex 1.20.5.580 41 4 65 2.14 3.25
1slqF02 80.89 Outer capsid protein VP4Rhesus rotavirus 1.20.5.170 32 6 53 0.61 1.14
2hr3A01 80.87 Probable transcriptional regulatorPseudomonas aeruginosa 1.20.5.420 30 6 73 3.43 4.69
1owaA01 80.81 Structural constituent of cytoskeletonSpectrinHomo sapiensSpectrin-associated cytoskeletonActin filament organization 1.20.5.170 32 3 70 2.54 3.59
1ow6A01 80.69 Focal adhesion kinase 1Focal adhesionCytoskeletonIntegrin-mediated signaling pathwayHomo sapiens 1.20.5.540 30 3 56 1.73 3.08
1s5lX00 80.52 Photosystem II reaction center X proteinThermosynechococcus elongatus BP-1 1.20.5.510 40 5 75 2.95 3.90
1k04A01 80.46 Focal adhesion kinase 1Focal adhesionIntegrin-mediated signaling pathwayCytoskeletonHomo sapiens 1.20.5.540 38 2 56 1.55 2.76
1r8eA03 80.40 Multidrug-efflux transporter 1 regulatorBacillus subtilis 1.20.5.490 44 7 56 1.87 3.29
1dipB01 80.10 Sus scrofaTSC22 domain family protein 3 1.20.5.490 45 2 57 1.40 2.42
1g2cB00 79.81 Human respiratory syncytial virus strain RSS-2Fusion glycoprotein F0 1.20.5.170 40 7 56 1.91 3.40
1s3jB01 79.78 Bacillus subtilisUncharacterized HTH-type transcriptional regulator yusO 1.20.5.420 30 10 65 1.89 2.87
1kv4A00 79.52 Moricin-1Bombyx mori 1.20.5.750 42 4 69 3.30 4.78
1kmiZ01 79.52 Bacterial chemotaxisChemotaxis protein cheZProtein bindingChemotaxis protein CheZEscherichia coli K-12 1.20.5.590 30 10 56 1.62 2.89
1hj0A00 79.52 Bos taurusThymosin beta-10 1.20.5.520 41 7 90 3.57 3.96
1fdoA05 79.33 Methane metabolismMetabolic pathwaysGlyoxylate and dicarboxylate metabolismFormate dehydrogenase HFormate dehydrogenase, alpha subunit [EC:1.2.1.2] 1.20.5.460 27 14 58 1.74 2.97
2zxeB01 79.00 1.20.5.170 35 5 48 0.49 1.00
3effK02 78.90 Streptomyces lividansVoltage-gated potassium channel 1.20.5.440 45 12 66 2.94 4.41
3efgA00 78.64 Xanthomonas campestris pv. campestrisSlyX proteinProtein slyX homolog 1.20.5.300 49 7 48 0.84 1.71
3bz1H01 78.37 PhotosynthesisThermosynechococcus elongatus BP-1Photosystem II PsbH proteinPhotosystem II reaction center protein HMetabolic pathways 1.20.5.880 51 9 54 2.30 4.19
2oarE02 78.28 Large conductance mechanosensitive channel, MscL familyLarge-conductance mechanosensitive channelMycobacterium tuberculosis H37Ra 1.20.5.220 22 9 48 0.74 1.52
1h8bB00 78.23 TitinOryctolagus cuniculus 1.20.5.510 23 8 56 2.07 3.69
1fs0E02 77.76 Oxidative phosphorylationMetabolic pathwaysATP synthase epsilon chainF-type H+-transporting ATPase subunit epsilon [EC:3.6.3.14]Escherichia coli K-12 1.20.5.440 38 7 46 0.52 1.12
1piqA00 77.40 NucleusPositive regulation of RNA polymerase II transcriptional preinitiation complex assemblyGeneral control protein GCN4General control protein GCN4Specific RNA polymerase II transcription factor activity 1.20.5.170 31 3 46 0.51 1.10
1vf5C03 77.19 Mastigocladus laminosusApocytochrome f 1.20.5.700 32 6 63 2.17 3.42
1jmmA01 77.03 Major cell-surface adhesin PAcStreptococcus mutans 1.20.5.250 32 12 51 1.08 2.11
2zjsE00 76.94 Protein exportBacterial secretion systemThermus thermophilus HB8Preprotein translocase subunit secEPreprotein translocase subunit SecE 1.20.5.1030 46 4 63 2.78 4.41
2o01J01 76.69 Photosystem I reaction center subunit IXSpinacia oleracea 1.20.5.510 25 8 58 2.44 4.17
1mqsB00 76.38 Vesicle fusionSyntaxin 5SNAP receptor activityER to Golgi vesicle-mediated transportRetrograde vesicle-mediated transport, Golgi to ER 1.20.5.460 26 3 51 2.29 4.47
1omiA02 76.26 Listeria monocytogenesListeriolysin regulatory protein 1.20.5.460 27 7 46 1.15 2.48
1ifpA00 76.07 Pseudomonas phage Pf3Capsid protein G8P 1.20.5.440 44 7 47 0.87 1.82
2qjyC01 76.05 Oxidative phosphorylationMetabolic pathwaysRhodobacter sphaeroidesUbiquinol-cytochrome c reductase iron-sulfur subunitUbiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2] 1.20.5.510 33 9 48 1.71 3.51
3clqB01 75.96 Enterococcus faecalisPutative uncharacterized protein 1.20.5.220 24 16 46 0.84 1.81
3cx5E01 75.87 Cytochrome b-c1 complex subunit Rieske, mitochondrialMitochondrial respiratory chain complex IIIOxidative phosphorylationMetabolic pathwaysAerobic respiration 1.20.5.270 55 7 47 1.42 3.00
1n2dC00 75.87 Mating projection tipGolgi inheritanceActin filament bindingVesicle-mediated transportMyosin-2 1.20.5.190 48 9 41 0.59 1.42
3c8vA04 75.75 Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein 1.20.5.510 19 10 46 0.84 1.81
3b4sA02 75.31 Vibrio parahaemolyticusLuxT 1.20.5.830 41 2 43 0.62 1.41
2oarA02 75.23 Large conductance mechanosensitive channel, MscL familyLarge-conductance mechanosensitive channelMycobacterium tuberculosis H37Ra 1.20.5.220 17 11 41 0.48 1.16
1jocA01 74.76 Zinc ion bindingVesicle fusionMembrane fractionSynaptic vesicle to endosome fusionProtein homodimerization activity 1.20.5.390 60 7 41 1.41 3.38
1ci6A00 74.53 Positive regulation of transcription from RNA polymerase II promoterCellular amino acid metabolic processNeurotrophin signaling pathwayActivating transcription factor 4Sequence-specific DNA binding transcription factor activity 1.20.5.170 56 9 44 1.47 3.29
3ii6A02 74.41 DNA ligation involved in DNA repairProtein C-terminus bindingDNA-dependent protein kinase-DNA ligase 4 complexResponse to X-rayDouble-strand break repair via nonhomologous end joining 1.20.5.370 58 2 48 2.03 4.21
1wa9B03 74.37 Regulation of circadian sleep/wake cycle, sleepPeriod circadian proteinNucleusResponse to temperature stimulusNegative regulation of transcription from RNA polymerase II promoter 1.20.5.770 33 3 46 1.23 2.65
2p10B02 74.25 Mesorhizobium lotiMll9387 protein 1.20.5.460 26 7 51 2.07 4.04
1mslA02 73.33 1.20.5.220 18 11 43 1.08 2.46
1k87A01 73.13 Arginine and proline metabolismMetabolic pathwaysAlanine, aspartate and glutamate metabolism1-pyrroline-5-carboxylate dehydrogenase activityBifunctional protein putA 1.20.5.550 52 7 42 1.24 2.93
2qiwA02 73.00 Corynebacterium glutamicumPEP phosphonomutase and related enzymes 1.20.5.510 18 11 43 0.99 2.25
1be3K00 72.94 Cardiac muscle contractionCytochrome b-c1 complex subunit 10Oxidative phosphorylationParkinson's diseaseAlzheimer's disease 1.20.5.220 22 9 43 1.76 4.01
1jekA00 72.67 Visna/maedi virus EV1 KV1772Envelope glycoprotein gp160 1.20.5.440 40 2 36 0.27 0.74
2qsiA02 72.50 Putative hydrogenase expression/formation protein hupGHydrogenase-1 operon protein HyaERhodopseudomonas palustris 1.20.5.510 27 7 43 1.81 4.12
1d66B02 72.36 Regulatory protein GAL4NucleusSequence-specific DNA binding transcription factor activityTranscription activator activityPositive regulation of transcription by galactose 1.20.5.640 15 13 36 0.60 1.64
3e7kA00 72.12 Rattus norvegicusCalcium channel activityCalcium ion transportIntegral to membraneProtein binding 1.20.5.1010 54 9 35 0.50 1.42
2w83C00 71.65 Homo sapiensIntegral to membraneC-Jun-amino-terminal kinase-interacting protein 4SpermatogenesisPositive regulation of cell migration 1.20.5.1000 67 9 35 0.95 2.65
1onvB00 70.95 CTD phosphatase activityProtein dephosphorylationHomo sapiensRNA polymerase II subunit A C-terminal domain phosphataseDNA-directed RNA polymerase activity 1.20.5.670 21 4 51 2.38 4.65
2i8dA02 70.03 Hypothetical proteinLactobacillus casei ATCC 334Putative uncharacterized protein 1.20.5.420 30 3 36 0.53 1.45
2basA02 69.63 Bacillus subtilisUncharacterized EAL-domain containing protein ykuI 1.20.5.170 46 2 39 1.53 3.91
1mkmA02 68.93 Thermotoga maritimaTranscriptional regulator, IclR family 1.20.5.640 14 0 34 0.63 1.84
1no4C00 66.70 Bacillus phage phi29Head morphogenesis protein 1.20.5.400 73 2 31 1.26 4.00
2wscH01 57.64 Photosystem I reaction center subunit VI, chloroplasticSpinacia oleracea 1.20.5.220 23 4 31 1.48 4.67
[1]
Displaying entries 1 to 63 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pjuD03
SAATVRQAFSDALDMTRMSLRHNTHDATTRYVLEGHHHHHH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pjuD03
SAATVRQAFSDALDMTRMSLRHNTHDATRNALRTRYVLEGHHHHHH
BLAST against CATH

[top]
Domain History Events (69)

Domain assigned by cuff on 14 May 2008 13:49

same superfamily

Domain assignment manual match h by cuff on 14 May 2008 13:48

same superfamily

Domain assignment manual match t by tronnberg on 19 Sep 2007 15:25

SSAP: 80.6 OV: 60 SEQ: 5. Differ with one small alfa helix. None of the matches which has a assigned CATH code has the same function as the query.

Homcheck review by tronnberg on 19 Sep 2007 15:25

SSAP: 80.6 OV: 60 SEQ: 5. Differ with one small alfa helix. None of the matches which has a assigned CATH code has the same function as the query.

Flow stage update by tronnberg on 19 Sep 2007 15:25

SSAP: 80.6 OV: 60 SEQ: 5. Differ with one small alfa helix. None of the matches which has a assigned CATH code has the same function as the query.

Homcheck allotment by tronnberg on 19 Sep 2007 15:14

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 19 Sep 2007 15:14

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 21:14

Domain "2pjuD03" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 21:13

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pjuD03

Flow stage update by auto on 15 Sep 2007 17:37

Retrieved PRC_PFAMCATH results for job ID SID9972302897501352 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 17:36

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2pjuD03

Update comment by auto on 15 Sep 2007 09:28

PRC_PFAMCATH job SID9972302897501352 is not yet finished.

Prc pfamcath submit by auto on 15 Sep 2007 08:55

The entry "2pjuD03" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 08:55

The entry "2pjuD03" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 06:41

Retrieved SSAP results for job ID SID8443648022792042 and results inserted.

Domain scan ssap cath by auto on 15 Sep 2007 06:40

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1108 results for 2pjuD03

Update comment by auto on 09 Sep 2007 23:20

SSAP job SID8443648022792042 is not yet finished.

Flow stage update by auto on 09 Sep 2007 22:40

The entry "2pjuD03" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 09 Sep 2007 22:40

The entry "2pjuD03" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:11

Giving up on SSAP job SID5382226979328108 because submission time of Wed Sep 5 18:50:21 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:11:49 2007).

Update comment by auto on 05 Sep 2007 19:55

SSAP job SID5382226979328108 is not yet finished.

Flow stage update by auto on 05 Sep 2007 18:50

The entry "2pjuD03" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 18:50

The entry "2pjuD03" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 12:46

Retrieved PRC results for job ID SID6792797875790400 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 12:45

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2pjuD03

Flow stage update by auto on 04 Sep 2007 13:52

The entry "2pjuD03" has been submitted to the PRC webservice.

Prc cath submit by auto on 04 Sep 2007 13:52

The entry "2pjuD03" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 12:52

Retrieved HMM(SAM) results for job ID SID1246718374299168 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 12:51

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2pjuD03

Flow stage update by auto on 04 Sep 2007 10:24

The entry "2pjuD03" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Sep 2007 10:24

The entry "2pjuD03" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 05:51

Retrieved "2pjuD03" CATHEDRAL results for job ID SID9651928975540192 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 05:50

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 101 results for 2pjuD03

Cathedral cath submit by auto on 03 Sep 2007 14:26

The entry "2pjuD03" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:26

The entry "2pjuD03" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:41

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pjuD03.scanlist" for "2pjuD03"

Write scan list by auto on 03 Sep 2007 12:41

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pjuD03.scanlist" for domain "2pjuD03"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:22

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:13

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:15

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:42

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:16

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:33

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:07

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:17

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:12

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:32

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:38

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:16

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:43

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:05

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:24

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:29

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 18:34

Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 14:50

Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 28 Aug 2007 14:12

No satisfactory AssignClose result found.

Flow stage update by auto on 28 Aug 2007 14:05

No in_process hits for Domain "2pjuD03" ready to be processed

Flow stage update by auto on 28 Aug 2007 14:05

NW result present for Domain "2pjuD03"

Flow stage update by auto on 21 Aug 2007 10:06

All required files are present for Domain "2pjuD03"

Flow stage update by auto on 20 Aug 2007 17:33

Beginning processing for Domain "2pjuD03"

Insertion by cuff on 20 Aug 2007 14:17

nice chopping