CATH Domain: 2pjqA01 XML data for domain: 2pjqA01

Molscript image for 2pjqA01
2pjqA01
PDB coordinates for domain 2pjqA01

PDB 2pjq, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.472 Cyclin A; domain 1
1.10.472.50 HD-domain/PDEase-like Gene3D
1.10.472.50.2
1.10.472.50.2.1
1.10.472.50.2.1.1
1.10.472.50.2.1.1.1
1.10.472.50.2.1.1.1.1

[top]
Segment boundaries for domain 2pjqA01

Chopping figure for domain 2pjqA01
DomainStart PDB ResidueStop PDB Residue
2pjqA01 2 99
2pjqA02 101 215

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.472.50.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3djbA01 88.60 Bacillus thuringiensis serovar konkukianHydrolase, HD family 1.10.472.50 93 29 93 2.39 2.55
2pq7A00 77.28 Uncultured Thermotogales bacteriumPredicted HD superfamily hydrolase 1.10.3210.10 168 19 51 2.42 4.73
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pjqA01
ITETQLTAIQTYALQKLAHDHSGHGRDHLQRVNRLARRLAKDEGANLNLTLAAAWLHDVIDAHQDLIVQLNAQNVTADDQ
TAIFAIIDH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pjqA01
XAGDPXITETQLTAIQTYALQKLAHDHSGHGRDHLQRVNRLARRLAKDEGANLNLTLAAAWLHDVIDDKLXANPAKAHQD
LIVQLNAQNVTADDQTAIFAIIDH
BLAST against CATH

[top]
Domain History Events (12)

Domain assigned by auto on 25 Apr 2008 14:29

Assigning to "1.10.472.50" based on similarity with "2pjqC01"

Flow stage update by auto on 25 Apr 2008 14:27

No in_process hits for Domain "2pjqA01" ready to be processed

Update comment by auto on 25 Apr 2008 14:25

Domain "2pjqA01" hits Domain "2pjqC01" (97.1153846153846% over 100%) which is currently in process

Update comment by auto on 25 Apr 2008 14:13

Domain "2pjqA01" hits Domain "2pjqD01" (97.1153846153846% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2pjqA01" hits Domain "2pjqB01" (97.1153846153846% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2pjqA01" hits Domain "2pjqB01" (97.1153846153846% over 100%) which is currently in process

Update comment by auto on 28 Aug 2007 14:06

Domain "2pjqA01" hits Domain "2pjqB01" (97.1153846153846% over 100%) which is currently in process

Flow stage update by auto on 28 Aug 2007 14:05

Domain "2pjqA01" hits Domain "2pjqB01" (97.1153846153846% over 100%) which is currently in process

Flow stage update by auto on 28 Aug 2007 14:05

NW result present for Domain "2pjqA01"

Flow stage update by auto on 21 Aug 2007 10:06

All required files are present for Domain "2pjqA01"

Flow stage update by auto on 20 Aug 2007 17:33

Beginning processing for Domain "2pjqA01"

Insertion by auto on 20 Aug 2007 14:12

Final ChopClose added based on similarity with "2pjqB"