CATH Domain: 2pi2E00 XML data for domain: 2pi2E00

Molscript image for 2pi2E00
2pi2E00
PDB coordinates for domain 2pi2E00

PDB 2pi2, Chain E, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.50 OB fold (Dihydrolipoamide Acetyltransferase, E2P)
2.40.50.140 Nucleic acid-binding proteins Gene3D
2.40.50.140.9
2.40.50.140.9.1
2.40.50.140.9.1.1
2.40.50.140.9.1.1.3
2.40.50.140.9.1.1.3.1

[top]
Segment boundaries for domain 2pi2E00

Chopping figure for domain 2pi2E00
DomainStart PDB ResidueStop PDB Residue
2pi2E00 2 118

Structural Neighbourhood (12 entries)

There are 12 matching structural neighberhood comparisons for CATH ID 2.40.50.140.9.1.1.3.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 12 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3kdfB00 82.06 DNA-dependent DNA replicationReplication protein A 32 kDa subunitNucleotide excision repairDNA replicationReplication factor A2 2.40.50.140 113 10 83 3.00 3.61
1ltlA02 81.50 Methanothermobacter thermautotrophicus str. Delta HDNA replication initiator (Cdc21/Cdc54)Replicative DNA helicase Mcm [EC:3.6.1.-] 2.40.50.140 100 17 67 2.06 3.06
1nnxA00 80.85 Escherichia coli O157:H7Protein ygiW 2.40.50.200 93 10 72 2.77 3.81
1lm0A00 79.11 Cytochrome c-type biogenesis protein ccmECytochrome c-type biogenesis protein CcmEShewanella oneidensis 2.40.50.140 101 6 73 2.28 3.10
2vw9B00 77.53 Homologous recombinationDNA replicationHelicobacter pyloriSingle-strand DNA-binding proteinSingle-stranded DNA-binding protein 2.40.50.140 105 15 59 2.49 4.21
1wocC00 77.45 Homologous recombinationPrimosomal replication protein NEscherichia coli K-12Primosomal replication protein n 2.40.50.140 98 6 58 2.44 4.19
2oq0B02 76.91 Gamma-interferon-inducible protein 16NucleolusMonocyte differentiationDouble-stranded DNA bindingProtein binding 2.40.50.140 86 12 65 2.25 3.44
1fguB01 76.43 Replication factor A1DNA-dependent DNA replicationDNA replicationNucleotide excision repairReplication protein A 70 kDa DNA-binding subunit 2.40.50.140 105 5 65 2.63 4.02
2hqlA01 76.26 Uncharacterized protein MG376 homologMycoplasma pneumoniae 2.40.50.140 91 8 57 2.66 4.64
2jqoA01 75.59 Bacillus subtilisUncharacterized protein yobA 2.40.50.140 88 9 54 2.34 4.29
1cukA01 74.75 Homologous recombinationHolliday junction ATP-dependent DNA helicase ruvAHolliday junction DNA helicase RuvAEscherichia coli K-12 2.40.50.140 66 6 53 2.50 4.66
2zteA01 73.75 Homologous recombinationHolliday junction ATP-dependent DNA helicase ruvAHolliday junction DNA helicase RuvAMycobacterium tuberculosis 2.40.50.140 65 7 52 2.21 4.19
[1]
Displaying entries 1 to 12 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pi2E00
VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILC
TSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pi2E00
VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILC
TSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 28 Nov 2007 02:50

Assigning to "2.40.50.140" based on similarity with "2pi2H00"

Flow stage update by auto on 28 Nov 2007 02:50

No in_process hits for Domain "2pi2E00" ready to be processed

Update comment by auto on 28 Nov 2007 02:41

Domain "2pi2E00" hits Domain "2pi2H00" (100% over 100%) which is currently in process

Update comment by auto on 27 Nov 2007 22:24

Domain "2pi2E00" hits Domain "2pi2G00" (100% over 100%) which is currently in process

Flow stage update by auto on 27 Nov 2007 22:13

Domain "2pi2E00" hits Domain "2pi2G00" (100% over 100%) which is currently in process

Flow stage update by auto on 27 Nov 2007 22:13

NW result present for Domain "2pi2E00"

Flow stage update by auto on 24 Nov 2007 14:38

All required files are present for Domain "2pi2E00"

Flow stage update by auto on 23 Nov 2007 14:01

Beginning processing for Domain "2pi2E00"

Insertion by auto on 23 Nov 2007 10:51

Final ChopClose added based on similarity with "1l1oA"