CATH Domain: 2phzA02 XML data for domain: 2phzA02

Molscript image for 2phzA02
2phzA02
PDB coordinates for domain 2phzA02

PDB 2phz, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1980 Nitrogenase molybdenum iron protein domain Gene3D
3.40.50.1980.11
3.40.50.1980.11.1
3.40.50.1980.11.1.1
3.40.50.1980.11.1.1.2
3.40.50.1980.11.1.1.2.1

[top]
Segment boundaries for domain 2phzA02

Chopping figure for domain 2phzA02
DomainStart PDB ResidueStop PDB Residue
2phzA01 20 142
2phzA02 143 296

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.50.1980.11.1.1.2.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1efdN02 78.98 ABC transportersIron(3+)-hydroxamate-binding protein fhuDIron complex transport system substrate-binding proteinEscherichia coli K-12 3.40.50.1980 171 9 78 2.70 3.45
1n2zA02 75.83 ABC transportersPeriplasmic spaceVitamin B12-binding proteinCobalamin bindingVitamin B12 transport system substrate-binding protein 3.40.50.1980 126 11 79 3.69 4.63
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2phzA02
KEKKAKKIIADYEQDLKEIKTKINDKAKDSKALVIRIRQGNIYIYPEQVYFNSTLYGDLGLKAPNEVKAAKAQELSSLEK
LSENPDHIFVQFSDDENADKPDALKDLEKNPIWKSLKAVKEDHVYVNSVDPLAQGGTAWSKVRFLKAAAEKLT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2phzA02
KEKKAKKIIADYEQDLKEIKTKINDKAKDSKALVIRIRQGNIYIYPEQVYFNSTLYGDLGLKAPNEVKAAKAQELSSLEK
LSEXNPDHIFVQFSDDENADKPDALKDLEKNPIWKSLKAVKEDHVYVNSVDPLAQGGTAWSKVRFLKAAAEKLTQNLEHH
HHHH
BLAST against CATH

[top]
Domain History Events (54)

Domain assigned by cuff on 04 Apr 2008 13:27

same superfamily

Domain assignment manual match h by cuff on 04 Apr 2008 13:21

same function and same superfamily in scop

Homcheck review by tronnberg on 19 Sep 2007 14:26

SSAP: 74.7 OV: 79 SEQ: 12. Similar linkage and structure. Functionally different.

Flow stage update by tronnberg on 19 Sep 2007 14:26

SSAP: 74.7 OV: 79 SEQ: 12. Similar linkage and structure. Functionally different.

Domain assignment manual match t by tronnberg on 19 Sep 2007 14:26

SSAP: 74.7 OV: 79 SEQ: 12. Similar linkage and structure. Functionally different.

Homcheck allotment by tronnberg on 19 Sep 2007 14:24

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 19 Sep 2007 14:24

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 21:09

Domain "2phzA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 21:08

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2phzA02

Flow stage update by auto on 15 Sep 2007 17:31

Retrieved PRC_PFAMCATH results for job ID SID6174374876030984 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 17:29

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 5 results for 2phzA02

Update comment by auto on 15 Sep 2007 09:27

PRC_PFAMCATH job SID6174374876030984 is not yet finished.

Prc pfamcath submit by auto on 15 Sep 2007 08:54

The entry "2phzA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 08:54

The entry "2phzA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 06:31

Retrieved SSAP results for job ID SID8012168901090368 and results inserted.

Domain scan ssap cath by auto on 15 Sep 2007 06:29

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1673 results for 2phzA02

Update comment by auto on 09 Sep 2007 23:20

SSAP job SID8012168901090368 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:40

The entry "2phzA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:40

The entry "2phzA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:11

Giving up on SSAP job SID0531544517321753 because submission time of Wed Sep 5 18:49:47 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:11:18 2007).

Update comment by auto on 05 Sep 2007 19:55

SSAP job SID0531544517321753 is not yet finished.

Flow stage update by auto on 05 Sep 2007 18:49

The entry "2phzA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 18:49

The entry "2phzA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 12:41

Retrieved PRC results for job ID SID3978742604979328 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 12:40

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 4 results for 2phzA02

Prc cath submit by auto on 04 Sep 2007 13:51

The entry "2phzA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 13:51

The entry "2phzA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 12:47

Retrieved HMM(SAM) results for job ID SID7476645218058912 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 12:46

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 2phzA02

Sam cath submit by auto on 04 Sep 2007 10:23

The entry "2phzA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:23

The entry "2phzA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 05:46

Retrieved "2phzA02" CATHEDRAL results for job ID SID0029354607922472 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 05:44

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 469 results for 2phzA02

Cathedral cath submit by auto on 03 Sep 2007 14:25

The entry "2phzA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:25

The entry "2phzA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:40

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2phzA02.scanlist" for "2phzA02"

Write scan list by auto on 03 Sep 2007 12:40

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2phzA02.scanlist" for domain "2phzA02"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:22

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:13

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:15

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Sep 2007 14:13

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Sep 2007 14:05

No in_process hits for Domain "2phzA02" ready to be processed

Flow stage update by auto on 01 Sep 2007 14:05

NW result present for Domain "2phzA02"

Flow stage update by auto on 30 Aug 2007 10:04

All required files are present for Domain "2phzA02"

Flow stage update by auto on 29 Aug 2007 14:34

Beginning processing for Domain "2phzA02"

Insertion by cuff on 29 Aug 2007 11:17

nice chopping