CATH Domain: 2phzA01 XML data for domain: 2phzA01

Molscript image for 2phzA01
2phzA01
PDB coordinates for domain 2phzA01

PDB 2phz, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1980 Nitrogenase molybdenum iron protein domain Gene3D
3.40.50.1980.4
3.40.50.1980.4.1
3.40.50.1980.4.1.1
3.40.50.1980.4.1.1.2
3.40.50.1980.4.1.1.2.1

[top]
Segment boundaries for domain 2phzA01

Chopping figure for domain 2phzA01
DomainStart PDB ResidueStop PDB Residue
2phzA01 20 142
2phzA02 143 296

Structural Neighbourhood (12 entries)

There are 12 matching structural neighberhood comparisons for CATH ID 3.40.50.1980.4.1.1.2.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 12 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1efdN01 81.47 ABC transportersIron(3+)-hydroxamate-binding protein fhuDIron complex transport system substrate-binding proteinEscherichia coli K-12 3.40.50.1980 91 17 69 2.38 3.45
1n2zA01 81.09 ABC transportersPeriplasmic spaceVitamin B12-binding proteinCobalamin bindingVitamin B12 transport system substrate-binding protein 3.40.50.1980 119 16 81 2.62 3.21
1a04A01 77.17 Two-component systemTwo-component system, NarL family, nitrate/nitrite response regulator NarLProtein bindingEscherichia coli K-12Nitrate/nitrite response regulator protein narL 3.40.50.2300 124 12 69 3.24 4.64
1pq4A02 75.34 Periplasmic binding protein component of an ABC type zinc uptake transporterZinc transport system substrate-binding proteinABC transportersSynechocystis sp. PCC 6803 3.40.50.1980 103 7 67 3.18 4.71
2rgyA01 74.87 LacI family transcriptional regulatorBurkholderia phymatum STM815Transcriptional regulator, LacI family 3.40.50.2300 122 4 69 3.39 4.91
2b4aA00 74.48 BH3024 proteinBacillus halodurans 3.40.50.2300 116 5 69 3.23 4.68
1srrC00 74.42 Sporulation initiation phosphotransferase FTwo-component system, response regulator, stage 0 sporulation protein FBacillus subtilisTwo-component system 3.40.50.2300 121 9 69 3.30 4.78
3cx3A02 74.02 ABC transportersLipoproteinZinc transport system substrate-binding proteinStreptococcus pneumoniae R6 3.40.50.1980 107 11 69 3.17 4.59
2qsjB00 73.64 DNA-binding response regulator, LuxR familyRuegeria pomeroyi 3.40.50.2300 122 8 66 3.27 4.91
1mb3A00 73.43 Caulobacter vibrioidesTwo-component systemTwo-component system, cell cycle response regulator DivKPolar differentiation response regulatorCell cycle - Caulobacter 3.40.50.2300 115 11 66 3.21 4.81
2zayA00 73.27 Response regulator receiver proteinDesulfuromonas acetoxidans DSM 684 3.40.50.2300 123 6 68 3.37 4.94
2qzjA00 72.87 Two-component response regulatorClostridium difficile 630 3.40.50.2300 119 10 67 3.32 4.92
[1]
Displaying entries 1 to 12 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2phzA01
KKIEYLDKTYEVTVPTDKIAITGSVESEDAKLLDVHPQGAISFSGKFPDFKDITDKAEPTGEKEPNIEKILEKPDVILAS
TKFPEKTLQKISTAGTTIPVSHISSNWKENLLAQLTG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2phzA01
KKIEYLDKTYEVTVPTDKIAITGSVESXEDAKLLDVHPQGAISFSGKFPDXFKDITDKAEPTGEKXEPNIEKILEXKPDV
ILASTKFPEKTLQKISTAGTTIPVSHISSNWKENXXLLAQLTG
BLAST against CATH

[top]
Domain History Events (54)

Domain assigned by cuff on 04 Apr 2008 13:16

same superfamily

Domain assignment manual match h by cuff on 04 Apr 2008 13:15

same function, same superfamily in SCOP. def homologues

Domain assignment manual match t by tronnberg on 19 Sep 2007 14:22

SSAP: 80.5 OV: 83 SEQ: 15. Similar linkage and reasonable similar structure (differ with a beta sheet). Functionally different. None of the matches with a assaigned CATH code and a SSAP score of at leat 72 has the same function as the query.

Homcheck review by tronnberg on 19 Sep 2007 14:22

SSAP: 80.5 OV: 83 SEQ: 15. Similar linkage and reasonable similar structure (differ with a beta sheet). Functionally different. None of the matches with a assaigned CATH code and a SSAP score of at leat 72 has the same function as the query.

Flow stage update by tronnberg on 19 Sep 2007 14:22

SSAP: 80.5 OV: 83 SEQ: 15. Similar linkage and reasonable similar structure (differ with a beta sheet). Functionally different. None of the matches with a assaigned CATH code and a SSAP score of at leat 72 has the same function as the query.

Homcheck allotment by tronnberg on 19 Sep 2007 14:14

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 19 Sep 2007 14:14

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 21:08

Domain "2phzA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 21:07

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2phzA01

Flow stage update by auto on 15 Sep 2007 17:29

Retrieved PRC_PFAMCATH results for job ID SID5041237999013616 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 17:28

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 5 results for 2phzA01

Update comment by auto on 15 Sep 2007 09:27

PRC_PFAMCATH job SID5041237999013616 is not yet finished.

Flow stage update by auto on 15 Sep 2007 08:54

The entry "2phzA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 15 Sep 2007 08:54

The entry "2phzA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 06:28

Retrieved SSAP results for job ID SID6276224083271960 and results inserted.

Domain scan ssap cath by auto on 15 Sep 2007 06:26

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1603 results for 2phzA01

Update comment by auto on 09 Sep 2007 23:19

SSAP job SID6276224083271960 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:39

The entry "2phzA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:39

The entry "2phzA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:11

Giving up on SSAP job SID5186246744234764 because submission time of Wed Sep 5 18:49:40 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:11:12 2007).

Update comment by auto on 05 Sep 2007 19:55

SSAP job SID5186246744234764 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 18:49

The entry "2phzA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 18:49

The entry "2phzA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 12:40

Retrieved PRC results for job ID SID6758132765222376 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 12:39

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 6 results for 2phzA01

Flow stage update by auto on 04 Sep 2007 13:51

The entry "2phzA01" has been submitted to the PRC webservice.

Prc cath submit by auto on 04 Sep 2007 13:51

The entry "2phzA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 12:46

Retrieved HMM(SAM) results for job ID SID0067083770985984 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 12:45

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2phzA01

Flow stage update by auto on 04 Sep 2007 10:23

The entry "2phzA01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Sep 2007 10:23

The entry "2phzA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 05:44

Retrieved "2phzA01" CATHEDRAL results for job ID SID9293592742498176 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 05:43

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 482 results for 2phzA01

Flow stage update by auto on 03 Sep 2007 14:25

The entry "2phzA01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Sep 2007 14:25

The entry "2phzA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:40

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2phzA01.scanlist" for "2phzA01"

Write scan list by auto on 03 Sep 2007 12:40

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2phzA01.scanlist" for domain "2phzA01"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:22

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:13

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:15

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Sep 2007 14:13

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Sep 2007 14:05

No in_process hits for Domain "2phzA01" ready to be processed

Flow stage update by auto on 01 Sep 2007 14:05

NW result present for Domain "2phzA01"

Flow stage update by auto on 30 Aug 2007 10:04

All required files are present for Domain "2phzA01"

Flow stage update by auto on 29 Aug 2007 14:34

Beginning processing for Domain "2phzA01"

Insertion by cuff on 29 Aug 2007 11:17

nice chopping