CATH Domain: 2phpB00 XML data for domain: 2phpB00

Molscript image for 2phpB00
2phpB00
PDB coordinates for domain 2phpB00

PDB 2php, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.225 L-fuculose-1-phosphate Aldolase
3.40.225.10 L-fuculose-1-phosphate Aldolase Gene3D
3.40.225.10.5
3.40.225.10.5.1
3.40.225.10.5.1.1
3.40.225.10.5.1.1.1
3.40.225.10.5.1.1.1.1

[top]
Segment boundaries for domain 2phpB00

Chopping figure for domain 2phpB00
DomainStart PDB ResidueStop PDB Residue
2phpB00 238 423

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2phpB00
SLTYINKEKVIKNLSYAIYLLKKNFTLIPEVGSNIAESLPFPKDFKDVAALTGRIIKNKLGGFYIVGDIEFGASEHIAKI
ILSASKFNPEIRACNIKYDGGLIKLLKDKFAVSSFDRKEEPPNVSTEWGTKIACEKFGGVPDIIYDRGGEGKEPIRVLGR
DAIEVVKKVEVIQKIYNTLEGH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2phpB00
XSLTYINKEKVIKNLSYAIYLLKKXNFTLIPEVGSNIAESLPFPKDFKDVAALTGRIIKNKLGGFYIVGDIEFGASEHIA
KIILSASKFNPEIRACXNIKYDGGLIKLLKDKFAVSSFDRKEEPPNVSTXEWGTKIACEKFGGVPDIIYDRGGEGKEPXI
RVLGRDAIEVVKKVEVIQKIYNTLEGHHHHHH
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 09 Apr 2008 17:15

Assigning to "3.40.225.10" based on similarity with "2pb9A00"

Flow stage update by auto on 09 Apr 2008 17:13

No in_process hits for Domain "2phpB00" ready to be processed

Update comment by auto on 09 Apr 2008 17:05

Domain "2phpB00" hits Domain "2pb9A00" (41.1458333333333% over 89.2307692307692%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2phpB00" hits Domain "2pb9B00" (41.1458333333333% over 89.2307692307692%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2phpB00" hits Domain "2pb9B00" (41.1458333333333% over 89.2307692307692%) which is currently in process

Update comment by auto on 28 Aug 2007 14:06

Domain "2phpB00" hits Domain "2pb9B00" (41.1458333333333% over 89.2307692307692%) which is currently in process

Flow stage update by auto on 28 Aug 2007 14:05

Domain "2phpB00" hits Domain "2pb9B00" (41.1458333333333% over 89.2307692307692%) which is currently in process

Flow stage update by auto on 28 Aug 2007 14:05

NW result present for Domain "2phpB00"

Flow stage update by auto on 21 Aug 2007 10:06

All required files are present for Domain "2phpB00"

Flow stage update by auto on 20 Aug 2007 17:33

Beginning processing for Domain "2phpB00"

Insertion by cuff on 20 Aug 2007 10:47

nice chopping