Domain assigned by cuff on 24 Apr 2008 12:39
same superfamily
CATH Domain: 2phcB02
2phcB02
PDB 2phc, Chain B, Domain 2
| CATH Code | Level Description | Links |
|---|---|---|
 2
| Mainly Beta | |
 2.40
| Beta Barrel | |
 2.40.100
| Cyclophilin | |
 2.40.100.10
| Cyclophilin | Gene3D |
 2.40.100.10.8
| ||
 2.40.100.10.8.1
| ||
 2.40.100.10.8.1.1
| ||
 2.40.100.10.8.1.1.1
| ||
 2.40.100.10.8.1.1.1.1
|
Segment boundaries for domain 2phcB02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2phcB01 | 2 | 84 |
| 2phcB02 | 85 | 217 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 2.40.100.10.8.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
|
1x7fA02 | 78.83 | 2.40.100.10 | 119 | 10 | 77 | 3.50 | 4.53 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|2phcB02 TIEIPVAYGGEFGPDIEFVAQYNGLSVDDVIEIHSKPLYRVYFLGFLPGFAYLGGMDERIATPRLEKPRLKVPAGSVGIA GKQTGWYAIESPGGWRIIGRIPLRTFNPGKVPPSIVLPGDYVKFVPIDEKEFW
Domain History Events (54)
Domain assignment manual match h by cuff on 24 Apr 2008 12:37
same superfamily in scop, nice structural match
Domain assignment manual match t by tronnberg on 19 Sep 2007 14:14
SSAP: 71.6 OV: 65 SEQ: 6. Reasonable similar linkage and structure. The query's function is unknown.
Homcheck review by tronnberg on 19 Sep 2007 14:14
SSAP: 71.6 OV: 65 SEQ: 6. Reasonable similar linkage and structure. The query's function is unknown.
Flow stage update by tronnberg on 19 Sep 2007 14:14
SSAP: 71.6 OV: 65 SEQ: 6. Reasonable similar linkage and structure. The query's function is unknown.
Homcheck allotment by tronnberg on 19 Sep 2007 14:12
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 19 Sep 2007 14:12
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 15 Sep 2007 21:07
Domain "2phcB02" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 15 Sep 2007 21:06
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2phcB02
Flow stage update by auto on 15 Sep 2007 17:26
Retrieved PRC_PFAMCATH results for job ID SID5284656633184904 and results inserted.
Domain scan prc pfamcath by auto on 15 Sep 2007 17:25
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 2 results for 2phcB02
Update comment by auto on 15 Sep 2007 09:27
PRC_PFAMCATH job SID5284656633184904 is not yet finished.
Prc pfamcath submit by auto on 15 Sep 2007 08:54
The entry "2phcB02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 15 Sep 2007 08:54
The entry "2phcB02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 15 Sep 2007 06:20
Retrieved SSAP results for job ID SID6997036046891156 and results inserted.
Domain scan ssap cath by auto on 15 Sep 2007 06:18
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 721 results for 2phcB02
Update comment by auto on 09 Sep 2007 23:19
SSAP job SID6997036046891156 is not yet finished.
Ssap cath submit by auto on 09 Sep 2007 22:39
The entry "2phcB02" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 22:39
The entry "2phcB02" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 20:10
Giving up on SSAP job SID1807940522774632 because submission time of Wed Sep 5 18:49:17 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:10:53 2007).
Update comment by auto on 05 Sep 2007 19:55
SSAP job SID1807940522774632 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 18:49
The entry "2phcB02" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 18:49
The entry "2phcB02" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 12:36
Retrieved PRC results for job ID SID8780252230909600 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 12:35
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2phcB02
Flow stage update by auto on 04 Sep 2007 13:51
The entry "2phcB02" has been submitted to the PRC webservice.
Prc cath submit by auto on 04 Sep 2007 13:51
The entry "2phcB02" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 12:43
Retrieved HMM(SAM) results for job ID SID8572765605758256 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 12:42
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2phcB02
Sam cath submit by auto on 04 Sep 2007 10:23
The entry "2phcB02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 10:23
The entry "2phcB02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 05:40
Retrieved "2phcB02" CATHEDRAL results for job ID SID5991468343570112 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 05:39
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 153 results for 2phcB02
Cathedral cath submit by auto on 03 Sep 2007 14:25
The entry "2phcB02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 14:25
The entry "2phcB02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 12:40
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2phcB02.scanlist" for "2phcB02"
Write scan list by auto on 03 Sep 2007 12:40
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2phcB02.scanlist" for domain "2phcB02"
Update comment by auto on 03 Sep 2007 10:11
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:32
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:37
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:32
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:22
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:22
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:16
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:29
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:13
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:15
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:17
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Flow stage update by auto on 01 Sep 2007 14:12
No satisfactory AssignClose result found.
Flow stage update by auto on 01 Sep 2007 14:05
No in_process hits for Domain "2phcB02" ready to be processed
Flow stage update by auto on 01 Sep 2007 14:05
NW result present for Domain "2phcB02"
Flow stage update by auto on 24 Aug 2007 10:06
All required files are present for Domain "2phcB02"
Flow stage update by auto on 23 Aug 2007 18:40
Beginning processing for Domain "2phcB02"
Insertion by cuff on 23 Aug 2007 12:58
nice chopping
