Domain assigned by cuff on 14 Feb 2008 18:37
same superfamily
| CATH Code | Level Description | Links |
|---|---|---|
3
| Alpha Beta | |
3.20
| Alpha-Beta Barrel | |
3.20.20
| TIM Barrel | |
3.20.20.120
| Enolase superfamily | Gene3D |
3.20.20.120.4
| ||
3.20.20.120.4.1
| ||
3.20.20.120.4.1.1
| ||
3.20.20.120.4.1.1.1
| ||
3.20.20.120.4.1.1.1.1
|
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2pgeA01 | 3 | 136 |
| 2pgeA02 | 137 | 368 |
There are 34 matching structural neighberhood comparisons for CATH ID 3.20.20.120.4.1.1.1.1 (SIMAX score < 5)
>pdb|2pgeA02 RQEWFASDFTRGEKRIPVNGLIWMGEAAFMQEQIEAKLAEGYGCLKLKIDFDKECALLAGIRESFSPQQLEIRVDANGAF SPANAPQRLKRLSQFHLHSIEQPIRQHQWSEMAALCANSPLAIALDEELIGLGAEQRSAMLDAIRPQYIILKPSLLGGFH YAGQWIELARERGIGFWITSALESNLGLAAIAQWTALYQPTMPQGLGTGQLYTNNLPSNLAVDGGLLGV
same superfamily
overwhelming evidence for homology
SSAP: 84.9 OV: 96 SEQ: 21. Very similar linkage and structure. Functionally different. None of the matches with a assaigned CATH code has the same function as the query.
SSAP: 84.9 OV: 96 SEQ: 21. Very similar linkage and structure. Functionally different. None of the matches with a assaigned CATH code has the same function as the query.
SSAP: 84.9 OV: 96 SEQ: 21. Very similar linkage and structure. Functionally different. None of the matches with a assaigned CATH code has the same function as the query.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2pgeA02" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pgeA02
Retrieved PRC_PFAMCATH results for job ID SID1043246955242064 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 99 results for 2pgeA02
PRC_PFAMCATH job SID1043246955242064 is not yet finished.
The entry "2pgeA02" has been submitted to the PRC_PFAMCATH webservice.
The entry "2pgeA02" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID6719256295554752 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 888 results for 2pgeA02
SSAP job SID6719256295554752 is not yet finished.
The entry "2pgeA02" has been submitted to the SSAP webservice.
The entry "2pgeA02" has been submitted to the SSAP webservice.
Giving up on SSAP job SID9571952922977240 because submission time of Sun Sep 9 22:37:55 2007 is more than 345600 seconds older than current time (Sat Sep 15 02:55:13 2007).
SSAP job SID9571952922977240 is not yet finished.
The entry "2pgeA02" has been submitted to the SSAP webservice.
The entry "2pgeA02" has been submitted to the SSAP webservice.
Giving up on SSAP job SID5546071653189952 because submission time of Wed Sep 5 16:35:49 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:09:25 2007).
SSAP job SID5546071653189952 is not yet finished.
The entry "2pgeA02" has been submitted to the SSAP webservice.
The entry "2pgeA02" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID9206705593032608 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 35 results for 2pgeA02
The entry "2pgeA02" has been submitted to the PRC webservice.
The entry "2pgeA02" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID8556077852047008 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 34 results for 2pgeA02
HMM(SAM) job SID8556077852047008 is not yet finished.
The entry "2pgeA02" has been submitted to the HMM (SAM) webservice.
The entry "2pgeA02" has been submitted to the HMM (SAM) webservice.
Retrieved "2pgeA02" CATHEDRAL results for job ID SID2442971453579424 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 129 results for 2pgeA02
The entry "2pgeA02" has been submitted to the CATHEDRAL webservice.
The entry "2pgeA02" has been submitted to the CATHEDRAL webservice.
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pgeA02.scanlist" for "2pgeA02"
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pgeA02.scanlist" for domain "2pgeA02"
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2pgeA02" ready to be processed
NW result present for Domain "2pgeA02"
All required files are present for Domain "2pgeA02"
Beginning processing for Domain "2pgeA02"
nice chopping