CATH Domain: 2pgeA02 XML data for domain: 2pgeA02

Molscript image for 2pgeA02
2pgeA02
PDB coordinates for domain 2pgeA02

PDB 2pge, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.20 Alpha-Beta Barrel
3.20.20 TIM Barrel
3.20.20.120 Enolase superfamily Gene3D
3.20.20.120.4
3.20.20.120.4.1
3.20.20.120.4.1.1
3.20.20.120.4.1.1.1
3.20.20.120.4.1.1.1.1

Segment boundaries for domain 2pgeA02

Chopping figure for domain 2pgeA02
DomainStart PDB ResidueStop PDB Residue
2pgeA01 3 136
2pgeA02 137 368

Structural Neighbourhood (34 entries)

There are 34 matching structural neighberhood comparisons for CATH ID 3.20.20.120.4.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 34 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3dgbA02 86.13 Muconate cycloisomeraseToluene and xylene degradationMuconate cycloisomerase [EC:5.5.1.1]Benzoate degradation via hydroxylationFluorobenzoate degradation 3.20.20.120 236 22 95 2.82 2.96
2chrA02 85.94 Ralstonia eutropha JMP134Chloromuconate cycloisomeraseToluene and xylene degradationMuconate cycloisomerase [EC:5.5.1.1]Benzoate degradation via hydroxylation 3.20.20.120 202 17 86 2.24 2.60
1tkkA02 85.26 Bacillus subtilisL-Ala-D/L-Glu epimerase 3.20.20.120 244 17 91 3.15 3.43
2qvhA02 84.60 Ubiquinone and other terpenoid-quinone biosynthesisThermobifida fusca YXO-succinylbenzoate-CoA synthaseO-succinylbenzoate synthase [EC:4.2.1.113]Metabolic pathways 3.20.20.120 224 24 92 2.81 3.05
2oqyA02 84.37 Muconate cycloisomeraseOceanobacillus iheyensis 3.20.20.120 226 18 93 2.83 3.03
2pgwA02 84.21 Sinorhizobium melilotiToluene and xylene degradationBenzoate degradation via hydroxylationMuconate cycloisomerase [EC:5.5.1.1]Mandelate racemase/muconate lactonizing enzyme family protein 3.20.20.120 215 16 91 2.45 2.67
1jpdX02 83.98 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.20.20.120 207 18 89 2.61 2.92
2ovlA02 83.84 Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase 3.20.20.120 223 17 90 3.21 3.53
2zadA02 83.54 Thermotoga maritimaL-Ala-D/L-Glu epimerase 3.20.20.120 222 16 94 3.28 3.48
2qdeA02 83.44 Aromatoleum aromaticum EbN1Mandelate racemase/muconate lactonizing enzyme family protein 3.20.20.120 239 22 91 2.27 2.48
2nqlA02 83.40 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.20.20.120 214 16 91 2.92 3.18
2oztA02 83.39 Ubiquinone and other terpenoid-quinone biosynthesisThermosynechococcus elongatus BP-1O-succinylbenzoate synthase [EC:4.2.1.113]Tlr1174 proteinMetabolic pathways 3.20.20.120 201 23 85 2.55 2.98
3cb3A02 83.36 Toluene and xylene degradationPolaromonas sp. JS666Mandelate racemase [EC:5.1.2.2]Mandelate racemase/muconate lactonizing enzymeBenzoate degradation via hydroxylation 3.20.20.120 233 17 92 3.34 3.60
2qddA02 83.35 Mandelate racemase/muconate lactonizing enzyme, putativeRoseovarius nubinhibens ISM 3.20.20.120 236 19 92 3.13 3.39
1mdlA02 83.28 Mandelate racemasePseudomonas putida 3.20.20.120 230 15 92 2.59 2.80
2oqhA02 82.91 Putative isomeraseStreptomyces coelicolor 3.20.20.120 240 17 90 3.57 3.95
1r6wA01 82.90 Ubiquinone and other terpenoid-quinone biosynthesisMetabolic pathwaysMenaquinone biosynthetic processO-succinylbenzoate synthaseHydro-lyase activity 3.20.20.120 198 22 82 2.76 3.33
2pozH02 82.47 Putative dehydrataseMesorhizobium loti 3.20.20.120 246 13 89 3.41 3.81
3cyjA02 82.05 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like proteinToluene and xylene degradationMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylation 3.20.20.120 235 17 89 2.96 3.30
3cawA02 81.79 Ubiquinone and other terpenoid-quinone biosynthesisO-succinylbenzoate synthase [EC:4.2.1.113]Bdellovibrio bacteriovorusMetabolic pathwaysPutative uncharacterized protein 3.20.20.120 225 17 89 2.99 3.34
2oz8A02 81.63 Mesorhizobium lotiMll7089 protein 3.20.20.120 230 15 90 3.22 3.56
3fv9A02 81.56 Mandelate racemase/muconate lactonizing enzyme, putativeRoseovarius nubinhibens ISM 3.20.20.120 243 16 91 3.16 3.44
1yeyB02 81.31 Xanthomonas campestris pv. campestrisRTS beta protein 3.20.20.120 243 14 84 2.62 3.11
2qgyA02 81.09 3.20.20.120 231 13 94 3.63 3.83
2hzgA02 81.05 Rhodobacter sphaeroides 2.4.1Mandelate racemase/muconate lactonizing enzyme/Enolase superfamily 3.20.20.120 248 17 90 3.75 4.15
1ec7A02 80.82 Ascorbate and aldarate metabolismD-glucarate catabolic processGlucarate dehydratase activityGlucarate dehydrataseGlucarate dehydratase [EC:4.2.1.40] 3.20.20.120 261 17 82 3.03 3.68
1rvkA02 80.78 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.20.20.120 255 15 83 3.32 3.99
2podB02 80.62 Mandelate racemase / muconate lactonizing enzymeBurkholderia pseudomallei 3.20.20.120 251 15 86 3.24 3.73
3bjsA02 80.49 Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme 3.20.20.120 250 17 87 3.41 3.89
2qq6A02 80.49 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein 3.20.20.120 262 13 82 3.71 4.50
2pmqA02 80.18 Roseovarius sp. HTCC2601Mandelate racemase/muconate lactonizing enzyme 3.20.20.120 224 13 91 3.60 3.93
3go2A02 80.06 Burkholderia xenovorans LB400Putative uncharacterized protein 3.20.20.120 268 17 79 2.73 3.42
1tzzA02 79.68 Bradyrhizobium japonicumBll6730 protein 3.20.20.120 256 15 84 3.57 4.21
2oktA02 78.92 Ubiquinone and other terpenoid-quinone biosynthesisMetabolic pathwaysO-succinylbenzoic acid (OSB) synthetase, putativeStaphylococcus aureus subsp. aureus COLO-succinylbenzoate synthase [EC:4.2.1.113] 3.20.20.120 189 18 81 3.03 3.71
Displaying entries 1 to 34 (page 1 of 1)


Domain ATOM Sequence

>pdb|2pgeA02
RQEWFASDFTRGEKRIPVNGLIWMGEAAFMQEQIEAKLAEGYGCLKLKIDFDKECALLAGIRESFSPQQLEIRVDANGAF
SPANAPQRLKRLSQFHLHSIEQPIRQHQWSEMAALCANSPLAIALDEELIGLGAEQRSAMLDAIRPQYIILKPSLLGGFH
YAGQWIELARERGIGFWITSALESNLGLAAIAQWTALYQPTMPQGLGTGQLYTNNLPSNLAVDGGLLGV    

Domain COMBS Sequence

>pdb|2pgeA02
RQEWFASDFTRGEKRIPVNGLIWMGEAAFMQEQIEAKLAEGYGCLKLKIGAIDFDKECALLAGIRESFSPQQLEIRVDAN
GAFSPANAPQRLKRLSQFHLHSIEQPIRQHQWSEMAALCANSPLAIALDEELIGLGAEQRSAMLDAIRPQYIILKPSLLG
GFHYAGQWIELARERGIGFWITSALESNLGLAAIAQWTALYQPTMPQGLGTGQLYTNNLPSNLAVDGGLLGVSEGHHHHH
H    

Domain History Events (59)

Domain assigned by cuff on 14 Feb 2008 18:37

same superfamily

Domain assignment manual match h by cuff on 14 Feb 2008 18:37

overwhelming evidence for homology

Domain assignment manual match t by tronnberg on 19 Sep 2007 12:18

SSAP: 84.9 OV: 96 SEQ: 21. Very similar linkage and structure. Functionally different. None of the matches with a assaigned CATH code has the same function as the query.

Homcheck review by tronnberg on 19 Sep 2007 12:18

SSAP: 84.9 OV: 96 SEQ: 21. Very similar linkage and structure. Functionally different. None of the matches with a assaigned CATH code has the same function as the query.

Flow stage update by tronnberg on 19 Sep 2007 12:18

SSAP: 84.9 OV: 96 SEQ: 21. Very similar linkage and structure. Functionally different. None of the matches with a assaigned CATH code has the same function as the query.

Homcheck allotment by tronnberg on 19 Sep 2007 12:11

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 19 Sep 2007 12:11

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 17 Sep 2007 12:43

Domain "2pgeA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 17 Sep 2007 12:40

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pgeA02

Flow stage update by auto on 17 Sep 2007 11:33

Retrieved PRC_PFAMCATH results for job ID SID1043246955242064 and results inserted.

Domain scan prc pfamcath by auto on 17 Sep 2007 11:32

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 99 results for 2pgeA02

Update comment by auto on 16 Sep 2007 14:39

PRC_PFAMCATH job SID1043246955242064 is not yet finished.

Flow stage update by auto on 16 Sep 2007 14:38

The entry "2pgeA02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 16 Sep 2007 14:38

The entry "2pgeA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 16 Sep 2007 14:10

Retrieved SSAP results for job ID SID6719256295554752 and results inserted.

Domain scan ssap cath by auto on 16 Sep 2007 14:08

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 888 results for 2pgeA02

Update comment by auto on 15 Sep 2007 06:10

SSAP job SID6719256295554752 is not yet finished.

Flow stage update by auto on 15 Sep 2007 06:09

The entry "2pgeA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 15 Sep 2007 06:09

The entry "2pgeA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 02:55

Giving up on SSAP job SID9571952922977240 because submission time of Sun Sep 9 22:37:55 2007 is more than 345600 seconds older than current time (Sat Sep 15 02:55:13 2007).

Update comment by auto on 09 Sep 2007 23:18

SSAP job SID9571952922977240 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:37

The entry "2pgeA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:37

The entry "2pgeA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:09

Giving up on SSAP job SID5546071653189952 because submission time of Wed Sep 5 16:35:49 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:09:25 2007).

Update comment by auto on 05 Sep 2007 19:53

SSAP job SID5546071653189952 is not yet finished.

Flow stage update by auto on 05 Sep 2007 16:35

The entry "2pgeA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 16:35

The entry "2pgeA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 12:18

Retrieved PRC results for job ID SID9206705593032608 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 12:17

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 35 results for 2pgeA02

Prc cath submit by auto on 05 Sep 2007 04:19

The entry "2pgeA02" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 04:19

The entry "2pgeA02" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 00:47

Retrieved HMM(SAM) results for job ID SID8556077852047008 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 00:46

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 34 results for 2pgeA02

Update comment by auto on 04 Sep 2007 12:39

HMM(SAM) job SID8556077852047008 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:21

The entry "2pgeA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:21

The entry "2pgeA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 05:21

Retrieved "2pgeA02" CATHEDRAL results for job ID SID2442971453579424 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 05:20

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 129 results for 2pgeA02

Cathedral cath submit by auto on 03 Sep 2007 14:23

The entry "2pgeA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:23

The entry "2pgeA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:38

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pgeA02.scanlist" for "2pgeA02"

Write scan list by auto on 03 Sep 2007 12:38

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pgeA02.scanlist" for domain "2pgeA02"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:22

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:28

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:12

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:15

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Sep 2007 14:12

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Sep 2007 14:05

No in_process hits for Domain "2pgeA02" ready to be processed

Flow stage update by auto on 01 Sep 2007 14:05

NW result present for Domain "2pgeA02"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2pgeA02"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2pgeA02"

Insertion by cuff on 23 Aug 2007 12:58

nice chopping