CATH Domain: 2pgeA01 XML data for domain: 2pgeA01

Molscript image for 2pgeA01
2pgeA01
PDB coordinates for domain 2pgeA01

PDB 2pge, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.10 Enolase-like, N-terminal domain Gene3D
3.30.390.10.4
3.30.390.10.4.1
3.30.390.10.4.1.1
3.30.390.10.4.1.1.1
3.30.390.10.4.1.1.1.1

[top]
Segment boundaries for domain 2pgeA01

Chopping figure for domain 2pgeA01
DomainStart PDB ResidueStop PDB Residue
2pgeA01 3 136
2pgeA02 137 368

Structural Neighbourhood (21 entries)

There are 21 matching structural neighberhood comparisons for CATH ID 3.30.390.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 21 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1nu5A01 82.23 Chloromuconate cycloisomerasePseudomonas sp. P51 3.30.390.10 116 17 81 3.09 3.77
2oztA01 81.27 Ubiquinone and other terpenoid-quinone biosynthesisThermosynechococcus elongatus BP-1O-succinylbenzoate synthase [EC:4.2.1.113]Tlr1174 proteinMetabolic pathways 3.30.390.10 117 13 72 2.43 3.35
1tkkA01 81.23 Bacillus subtilisL-Ala-D/L-Glu epimerase 3.30.390.10 115 16 81 3.37 4.12
2pmqA01 81.17 Roseovarius sp. HTCC2601Mandelate racemase/muconate lactonizing enzyme 3.30.390.10 127 16 80 2.97 3.70
2zadA01 81.14 Thermotoga maritimaL-Ala-D/L-Glu epimerase 3.30.390.10 109 16 77 2.95 3.78
2ovlA01 80.68 Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase 3.30.390.10 123 14 79 3.47 4.36
3fv9D01 80.22 Mandelate racemase/muconate lactonizing enzyme, putativeRoseovarius nubinhibens ISM 3.30.390.10 130 16 80 3.10 3.88
1jpdX01 80.20 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.30.390.10 99 16 75 2.92 3.86
1mdlA01 79.84 Mandelate racemasePseudomonas putida 3.30.390.10 126 12 79 3.70 4.65
1tzzB01 79.76 Bradyrhizobium japonicumBll6730 protein 3.30.390.10 119 14 82 3.44 4.16
2og9A01 79.71 Toluene and xylene degradationPolaromonas sp. JS666Mandelate racemase [EC:5.1.2.2]Mandelate racemase/muconate lactonizing enzymeBenzoate degradation via hydroxylation 3.30.390.10 129 14 78 3.29 4.20
3dgbA01 79.49 Muconate cycloisomeraseToluene and xylene degradationMuconate cycloisomerase [EC:5.5.1.1]Benzoate degradation via hydroxylationMetabolic pathways 3.30.390.10 134 16 78 3.32 4.24
2qq6B01 78.93 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein 3.30.390.10 115 13 70 3.26 4.65
2oqyA01 78.90 Muconate cycloisomeraseOceanobacillus iheyensis 3.30.390.10 142 14 72 3.20 4.41
3go2A01 78.71 Burkholderia xenovorans LB400Putative uncharacterized protein 3.30.390.10 114 15 74 3.36 4.54
2oqhB01 78.58 Putative isomeraseStreptomyces coelicolor 3.30.390.10 129 12 72 3.15 4.32
1ec7C01 78.44 Ascorbate and aldarate metabolismD-glucarate catabolic processGlucarate dehydratase activityGlucarate dehydrataseGlucarate dehydratase [EC:4.2.1.40] 3.30.390.10 136 13 71 3.28 4.60
3bjsA01 78.08 Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme 3.30.390.10 116 10 78 3.70 4.70
2qgyB01 77.64 3.30.390.10 135 18 74 3.65 4.93
2qjjA01 77.39 Mandelate racemase/muconate lactonizing enzyme, N-terminal domain proteinStarvation sensing protein RspANovosphingobium aromaticivorans DSM 12444 3.30.390.10 140 11 66 3.14 4.73
3cawA01 76.33 Ubiquinone and other terpenoid-quinone biosynthesisO-succinylbenzoate synthase [EC:4.2.1.113]Bdellovibrio bacteriovorusMetabolic pathwaysPutative uncharacterized protein 3.30.390.10 91 14 58 2.41 4.14
[1]
Displaying entries 1 to 21 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pgeA01
SGMELSYRRSDLIFKRVLTSKPTWFVRLDIDGHGGQGEVSLIPGLSLDPEEQIGRELDLLARRLRAEEPIRLRQFLAERG
GADFSDYRSVLTDIAGILDSWQVSTDGRFPALRFALEMALLDLLSGG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pgeA01
SLSGMELSYRRSDLIFKRPAGTSRGVLTSKPTWFVRLDIDGHGGQGEVSLIPGLSLDPEEQIGRELDLLARRLRAEEPIR
LRQFLAERGGADFSDYRSVLTDIAGILDSWQVSTDGRFPALRFALEMALLDLLSGG
BLAST against CATH

[top]
Domain History Events (55)

Domain assigned by cuff on 14 Feb 2008 18:47

same superfamily

Domain assignment manual match h by cuff on 14 Feb 2008 18:46

nice scores and in same family in SCOP

Domain assignment manual match t by tronnberg on 19 Sep 2007 12:10

SSAP: 81.2 OV: 81 SEQ: 16. Similar linkage and structure (differ with one alfa helix). None of the matches with a assigned CATH code and a SSAP score of at least 70 has the same function as the query.

Homcheck review by tronnberg on 19 Sep 2007 12:10

SSAP: 81.2 OV: 81 SEQ: 16. Similar linkage and structure (differ with one alfa helix). None of the matches with a assigned CATH code and a SSAP score of at least 70 has the same function as the query.

Flow stage update by tronnberg on 19 Sep 2007 12:10

SSAP: 81.2 OV: 81 SEQ: 16. Similar linkage and structure (differ with one alfa helix). None of the matches with a assigned CATH code and a SSAP score of at least 70 has the same function as the query.

Homcheck allotment by tronnberg on 19 Sep 2007 12:06

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 19 Sep 2007 12:06

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 20:52

Domain "2pgeA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 20:51

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pgeA01

Flow stage update by auto on 15 Sep 2007 17:11

Retrieved PRC_PFAMCATH results for job ID SID8844552823317332 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 17:09

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 32 results for 2pgeA01

Update comment by auto on 15 Sep 2007 09:26

PRC_PFAMCATH job SID8844552823317332 is not yet finished.

Prc pfamcath submit by auto on 15 Sep 2007 08:52

The entry "2pgeA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 08:52

The entry "2pgeA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 02:55

Retrieved SSAP results for job ID SID8692567507788360 and results inserted.

Domain scan ssap cath by auto on 15 Sep 2007 02:52

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2548 results for 2pgeA01

Update comment by auto on 09 Sep 2007 23:18

SSAP job SID8692567507788360 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:37

The entry "2pgeA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:37

The entry "2pgeA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:09

Giving up on SSAP job SID8000123133578304 because submission time of Wed Sep 5 16:35:40 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:09:19 2007).

Update comment by auto on 05 Sep 2007 19:53

SSAP job SID8000123133578304 is not yet finished.

Flow stage update by auto on 05 Sep 2007 16:35

The entry "2pgeA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 16:35

The entry "2pgeA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 12:17

Retrieved PRC results for job ID SID1504613904710666 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 12:16

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 17 results for 2pgeA01

Prc cath submit by auto on 05 Sep 2007 04:19

The entry "2pgeA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 04:19

The entry "2pgeA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 00:46

Retrieved HMM(SAM) results for job ID SID8230878486496384 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 00:45

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 2pgeA01

Update comment by auto on 04 Sep 2007 12:39

HMM(SAM) job SID8230878486496384 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:21

The entry "2pgeA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:21

The entry "2pgeA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 05:20

Retrieved "2pgeA01" CATHEDRAL results for job ID SID9558859983929860 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 05:19

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 34 results for 2pgeA01

Flow stage update by auto on 03 Sep 2007 14:23

The entry "2pgeA01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Sep 2007 14:23

The entry "2pgeA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:38

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pgeA01.scanlist" for "2pgeA01"

Write scan list by auto on 03 Sep 2007 12:37

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pgeA01.scanlist" for domain "2pgeA01"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:22

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:28

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:12

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:15

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Sep 2007 14:12

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Sep 2007 14:05

No in_process hits for Domain "2pgeA01" ready to be processed

Flow stage update by auto on 01 Sep 2007 14:05

NW result present for Domain "2pgeA01"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2pgeA01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2pgeA01"

Insertion by cuff on 23 Aug 2007 12:58

nice chopping