CATH Domain: 2pgdA03 XML data for domain: 2pgdA03

Molscript image for 2pgdA03
2pgdA03
PDB coordinates for domain 2pgdA03

PDB 2pgd, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.5 Single alpha-helices involved in coiled-coils or other helix-helix interfaces
1.20.5.320 6-Phosphogluconate Dehydrogenase, domain 3 Gene3D
1.20.5.320.2
1.20.5.320.2.1
1.20.5.320.2.1.1
1.20.5.320.2.1.1.1
1.20.5.320.2.1.1.1.1

[top]
Segment boundaries for domain 2pgdA03

Chopping figure for domain 2pgdA03
DomainStart PDB ResidueStop PDB Residue
2pgdA01 1 180
2pgdA02 181 435
2pgdA03 436 473

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 1.20.5.320.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1pgjA03 88.86 6-phosphogluconate dehydrogenase, decarboxylatingTrypanosoma brucei brucei 1.20.5.320 34 32 89 2.99 3.34
2r44A01 67.43 Cytophaga hutchinsonii ATCC 33406MoxR-like ATPase [EC:3.6.3.-]Putative uncharacterized protein 1.20.5.420 26 0 39 1.91 4.84
1onvB00 61.51 CTD phosphatase activityProtein dephosphorylationHomo sapiensRNA polymerase II subunit A C-terminal domain phosphataseDNA-directed RNA polymerase activity 1.20.5.670 21 9 39 1.72 4.36
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pgdA03
MLPANLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pgdA03
MLPANLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGSVSSSSYNA
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "2pgd003" to "2pgdA03" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:17

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:17

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:55

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"