CATH Domain: 2pg0A01 XML data for domain: 2pg0A01

Molscript image for 2pg0A01
2pg0A01
PDB coordinates for domain 2pg0A01

PDB 2pg0, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.540 Butyryl-Coa Dehydrogenase, subunit A; domain 1
1.10.540.10 Butyryl-Coa Dehydrogenase, subunit A, domain 1 Gene3D
1.10.540.10.2
1.10.540.10.2.1
1.10.540.10.2.1.1
1.10.540.10.2.1.1.1
1.10.540.10.2.1.1.1.1

[top]
Segment boundaries for domain 2pg0A01

Chopping figure for domain 2pg0A01
DomainStart PDB ResidueStop PDB Residue
2pg0A01 8 124
2pg0A02 125 233
2pg0A03 236 384

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 1.10.540.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1siqA01 90.06 Fatty acid metabolismGlutaryl-CoA dehydrogenase [EC:1.3.99.7]Glutaryl-CoA dehydrogenase activityHomo sapiensGlutaryl-CoA dehydrogenase, mitochondrial 1.10.540.10 128 28 90 1.63 1.80
2vigA01 89.97 Fatty acid metabolismButyryl-CoA dehydrogenase [EC:1.3.99.2]Short-chain specific acyl-CoA dehydrogenase, mitochondrialValine, leucine and isoleucine degradationMetabolic pathways 1.10.540.10 116 31 98 1.45 1.48
1rx0C01 89.41 Lipid metabolic processIsobutyryl-CoA dehydrogenase [EC:1.3.99.-]Valine, leucine and isoleucine degradationHomo sapiensIsobutyryl-CoA dehydrogenase, mitochondrial 1.10.540.10 123 27 94 1.75 1.86
1bucA01 88.13 Acyl-CoA dehydrogenase, short-chain specificMegasphaera elsdenii 1.10.540.10 123 24 95 1.84 1.93
1ukwA01 87.82 Geraniol degradationThermus thermophilus HB27[EC:1.3.99.-]Putative acyl-CoA dehydrogenase1- and 2-Methylnaphthalene degradation 1.10.540.10 116 24 96 1.85 1.92
1r2jA01 84.77 Streptomyces hygroscopicus subsp. ascomyceticusFkbI 1.10.540.10 103 19 88 1.91 2.17
2rfqB01 79.71 Rhodococcus jostii RHA13-HSA hydroxylase, oxygenase 1.10.540.10 102 11 85 2.99 3.50
2ddhA01 78.71 Fatty acid metabolismPeroxisomeRattus norvegicusPPAR signaling pathwayPalmitoyl-CoA oxidase activity 1.10.540.10 118 10 88 4.32 4.85
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pg0A01
RYLREEHHMFRAAFRKFLEKEAYPHYNDWEKRGIIPRSFWAKMGENGFLCPWVDEKYGGLNADFAYSVVINEELEKVGSS
LVGIGLHNDIVTPYIASYGTEEQKQKWLPKCVTGELI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pg0A01
RYLREEHHMFRAAFRKFLEKEAYPHYNDWEKRGIIPRSFWAKMGENGFLCPWVDEKYGGLNADFAYSVVINEELEKVGSS
LVGIGLHNDIVTPYIASYGTEEQKQKWLPKCVTGELI
BLAST against CATH

[top]
Domain History Events (102)

Domain assigned by cuff on 02 Apr 2008 10:52

same superfamily

Domain assignment manual match h by tronnberg on 19 Sep 2007 11:51

SSAP: 90.2 OV: 99 SEQ: 27. Very similar linkage and structure. Share the same function as Acyl-coa dehydrogenase. I believe that 2jifA01 (TBA) should be assigned to the same H-family (has the same fucntion as the query and SSAP: 90.6 OV: 96 SEQ: 28).

Homcheck review by tronnberg on 19 Sep 2007 11:51

SSAP: 90.2 OV: 99 SEQ: 27. Very similar linkage and structure. Share the same function as Acyl-coa dehydrogenase. I believe that 2jifA01 (TBA) should be assigned to the same H-family (has the same fucntion as the query and SSAP: 90.6 OV: 96 SEQ: 28).

Flow stage update by tronnberg on 19 Sep 2007 11:51

SSAP: 90.2 OV: 99 SEQ: 27. Very similar linkage and structure. Share the same function as Acyl-coa dehydrogenase. I believe that 2jifA01 (TBA) should be assigned to the same H-family (has the same fucntion as the query and SSAP: 90.6 OV: 96 SEQ: 28).

Homcheck allotment by tronnberg on 19 Sep 2007 11:47

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 19 Sep 2007 11:47

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 20:49

Domain "2pg0A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 20:48

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pg0A01

Flow stage update by auto on 15 Sep 2007 17:07

Retrieved PRC_PFAMCATH results for job ID SID5127342173655256 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 17:06

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 11 results for 2pg0A01

Update comment by auto on 15 Sep 2007 09:25

PRC_PFAMCATH job SID5127342173655256 is not yet finished.

Prc pfamcath submit by auto on 15 Sep 2007 08:52

The entry "2pg0A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 08:52

The entry "2pg0A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 02:48

Retrieved SSAP results for job ID SID7897257010166864 and results inserted.

Domain scan ssap cath by auto on 15 Sep 2007 02:46

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2120 results for 2pg0A01

Update comment by auto on 09 Sep 2007 23:17

SSAP job SID7897257010166864 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:37

The entry "2pg0A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:37

The entry "2pg0A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:08

Giving up on SSAP job SID4685451306438976 because submission time of Wed Sep 5 16:35:15 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:09:00 2007).

Update comment by auto on 05 Sep 2007 19:53

SSAP job SID4685451306438976 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 16:35

The entry "2pg0A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 16:35

The entry "2pg0A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 12:13

Retrieved PRC results for job ID SID8936626508143168 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 12:12

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 12 results for 2pg0A01

Flow stage update by auto on 05 Sep 2007 04:19

The entry "2pg0A01" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 04:18

The entry "2pg0A01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 00:43

Retrieved HMM(SAM) results for job ID SID3642312481946208 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 00:42

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 12 results for 2pg0A01

Update comment by auto on 04 Sep 2007 12:39

HMM(SAM) job SID3642312481946208 is not yet finished.

Flow stage update by auto on 04 Sep 2007 10:20

The entry "2pg0A01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Sep 2007 10:20

The entry "2pg0A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 05:16

Retrieved "2pg0A01" CATHEDRAL results for job ID SID0002711202983488 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 05:15

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 135 results for 2pg0A01

Cathedral cath submit by auto on 03 Sep 2007 14:23

The entry "2pg0A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:23

The entry "2pg0A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:37

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pg0A01.scanlist" for "2pg0A01"

Write scan list by auto on 03 Sep 2007 12:37

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pg0A01.scanlist" for domain "2pg0A01"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:22

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:28

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:12

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:15

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:42

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:16

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:33

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:07

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:17

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:12

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:32

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:37

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:16

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:43

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:05

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:24

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:29

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 18:34

Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 14:50

Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 10:15

Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 08:13

Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 02:21

Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 22:21

Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 18:13

Waiting for 1755 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 14:13

Waiting for 1834 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 10:25

Waiting for 1921 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 06:31

Waiting for 1975 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 02:24

Waiting for 2046 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Aug 2007 22:19

Waiting for 2103 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Aug 2007 18:24

Waiting for 2173 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Aug 2007 14:22

Waiting for 2242 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Aug 2007 09:09

Waiting for 2372 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Aug 2007 02:17

Waiting for 2434 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Aug 2007 22:12

Waiting for 2493 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Aug 2007 18:12

Waiting for 2578 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Aug 2007 14:12

Waiting for 2669 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Aug 2007 10:12

Waiting for 2761 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Aug 2007 06:23

Waiting for 2809 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Aug 2007 02:22

Waiting for 2869 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Aug 2007 22:09

Waiting for 2923 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Aug 2007 18:33

Waiting for 2996 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Aug 2007 14:15

Waiting for 3074 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Aug 2007 10:17

Waiting for 3166 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Aug 2007 06:26

Waiting for 3217 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Aug 2007 02:28

Waiting for 3282 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Aug 2007 22:27

Waiting for 3342 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Aug 2007 18:54

Waiting for 3403 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Aug 2007 10:22

Waiting for 2829 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Aug 2007 06:23

Waiting for 2900 new domains (example : 1hi1C03) to be processed so that they can be scanned against too.

Update comment by auto on 23 Aug 2007 02:35

Waiting for 2964 new domains (example : 1h83B01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Aug 2007 22:16

Waiting for 3023 new domains (example : 1gn2C02) to be processed so that they can be scanned against too.

Update comment by auto on 22 Aug 2007 18:36

Waiting for 3103 new domains (example : 1ek1B03) to be processed so that they can be scanned against too.

Flow stage update by auto on 04 Aug 2007 18:46

No satisfactory AssignClose result found.

Flow stage update by auto on 04 Aug 2007 18:42

No in_process hits for Domain "2pg0A01" ready to be processed

Flow stage update by auto on 04 Aug 2007 18:42

NW result present for Domain "2pg0A01"

Flow stage update by auto on 14 Jul 2007 06:02

All required files are present for Domain "2pg0A01"

Flow stage update by auto on 13 Jul 2007 18:42

Beginning processing for Domain "2pg0A01"

Insertion by auto on 13 Jul 2007 15:41

Final ChopClose added based on similarity with "1ws9A"