CATH Domain: 2pfxA01 XML data for domain: 2pfxA01

Molscript image for 2pfxA01
2pfxA01
PDB coordinates for domain 2pfxA01

PDB 2pfx, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.5 Single alpha-helices involved in coiled-coils or other helix-helix interfaces
1.20.5.810 AhpD-like Gene3D
1.20.5.810.2
1.20.5.810.2.1
1.20.5.810.2.1.1
1.20.5.810.2.1.1.1
1.20.5.810.2.1.1.1.1

[top]
Segment boundaries for domain 2pfxA01

Chopping figure for domain 2pfxA01
DomainStart PDB ResidueStop PDB Residue
2pfxA01 15 65
2pfxA02 66 190

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.20.5.810.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2prrA01 89.26 Ralstonia eutropha JMP134Alkylhydroperoxidase AhpD core:Uncharacterised peroxidase-related 1.20.5.810 52 31 90 1.93 2.14
1l8qA02 75.63 Two-component systemChromosomal replication initiator proteinChromosomal replication initiator protein dnaAAquifex aeolicus 1.10.8.60 49 10 91 4.53 4.93
3bg3B04 75.46 Pyruvate carboxylase subunit A [EC:6.4.1.1]Citrate cycle (TCA cycle)Biotin bindingPyruvate metabolismPyruvate carboxylase, mitochondrial 1.10.10.60 44 11 91 4.26 4.66
3bg5B07 73.62 Citrate cycle (TCA cycle)Pyruvate metabolismMetabolic pathwaysPyruvate carboxylase subunit A [EC:6.4.1.1]Pyruvate carboxylase subunit B [EC:6.4.1.1] 1.10.10.60 46 6 91 4.55 4.97
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pfxA01
ADPLPDETQKYFEICQEKLGVPNVLKAYAFNVEKLNAFTAYNDLLGES
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pfxA01
ADPLPDETQKYFEICQEKLGXVPNVLKAYAFNVEKLNAFTAXYNDLXLGES
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 19 May 2008 14:19

Assigning to "1.20.5.810" based on similarity with "2pfxB01"

Flow stage update by auto on 19 May 2008 14:07

No in_process hits for Domain "2pfxA01" ready to be processed

Update comment by auto on 03 Sep 2007 20:10

Domain "2pfxA01" hits Domain "2pfxB01" (94.1176470588235% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2pfxA01" hits Domain "2pfxB01" (94.1176470588235% over 100%) which is currently in process

Update comment by auto on 01 Sep 2007 14:06

Domain "2pfxA01" hits Domain "2pfxB01" (94.1176470588235% over 100%) which is currently in process

Flow stage update by auto on 01 Sep 2007 14:05

Domain "2pfxA01" hits Domain "2pfxB01" (94.1176470588235% over 100%) which is currently in process

Flow stage update by auto on 01 Sep 2007 14:05

NW result present for Domain "2pfxA01"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2pfxA01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2pfxA01"

Insertion by auto on 23 Aug 2007 14:39

Final ChopClose added based on similarity with "2pfxB"