CATH Domain: 2pc1A00

There are 31 matching structural neighberhood comparisons for CATH ID 3.40.630.30.3.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	2fiaA00	87.34	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	157	19	89	2.81	3.15
	3blnA00	84.16	Bacillus cereus ATCC 10987Putative uncharacterized protein	3.40.630.30	139	17	83	2.91	3.48
	3fncA00	82.70	Listeria innocuaLin0611 protein	3.40.630.30	157	13	89	3.05	3.39
	1mk4A00	82.47	Bacillus subtilisUncharacterized protein yqjY	3.40.630.30	157	12	84	2.86	3.40
	3d3sA00	81.66	L-2,4-diaminobutyric acid acetyltransferaseGlycine, serine and threonine metabolismBordetella parapertussisL-2,4-diaminobutyric acid acetyltransferase [EC:2.3.1.178]Metabolic pathways	3.40.630.30	157	10	82	3.20	3.86
	3eo4A00	81.59	Methanocaldococcus jannaschiiUncharacterized protein MJ1062	3.40.630.30	155	11	87	3.44	3.91
	2q7bA00	81.57	Acetyltransferase, GNAT familyStreptococcus agalactiae serogroup V	3.40.630.30	161	12	85	3.27	3.84
	3fbuA00	81.56	Bacillus anthracisAcetyltransferase, GNAT family	3.40.630.30	166	9	86	3.46	3.99
	1vhsB00	81.54	Bacillus subtilisPhosphinothricin acetyltransferase [EC:2.3.1.183]Phosphonate and phosphinate metabolismPutative phosphinothricin acetyltransferase ywnH	3.40.630.30	155	12	86	3.88	4.47
	2r7hB00	81.47	Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein	3.40.630.30	157	10	84	2.92	3.44
	2ge3B00	81.44	Agrobacterium tumefaciens str. C58Probable acetyltransferase	3.40.630.30	159	12	88	4.13	4.66
	1gheA00	81.32	Tyrosine metabolismLimonene and pinene degradationAcetyltransferase1- and 2-Methylnaphthalene degradationPhenylalanine metabolism	3.40.630.30	166	13	83	3.72	4.47
	3exnA00	81.01	Tyrosine metabolismLimonene and pinene degradation1- and 2-Methylnaphthalene degradationPhenylalanine metabolismBenzoate degradation via CoA ligation	3.40.630.30	151	11	86	3.79	4.40
	2fckA00	80.47	Vibrio choleraeRibosomal-protein-serine acetyltransferase, putative	3.40.630.30	171	12	77	2.82	3.65
	2fiwA00	80.35	Putative acetyltransferase [EC:2.3.1.-]GCN5-related N-acetyltransferase:Aminotransferase, class-IIRhodopseudomonas palustris	3.40.630.30	156	8	84	3.81	4.53
	2oh1C00	80.03	Listeria monocytogenes serotype 4b str. F2365Acetyltransferase, GNAT family	3.40.630.30	166	19	85	3.85	4.50
	1tiqB00	79.86	Bacillus subtilisProtease synthase and sporulation negative regulatory protein PAI 1	3.40.630.30	161	17	84	3.66	4.33
	3efaA00	79.83	Tyrosine metabolismBenzoate degradation via CoA ligationLactobacillus plantarumAcetyltransferase (Putative)Limonene and pinene degradation	3.40.630.30	141	12	80	2.93	3.65
	2fsrA00	79.83	Agrobacterium tumefaciens str. C58Acetyltranferase	3.40.630.30	168	10	82	3.29	3.98
	3d8pB00	79.70	Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein	3.40.630.30	157	10	84	3.07	3.62
	3f5bA00	79.63	Aminoglycoside N(6')acetyltransferaseLegionella pneumophila subsp. pneumophila str. Philadelphia 1	3.40.630.30	163	10	88	4.25	4.81
	1yreC00	79.46	Pseudomonas aeruginosaPutative uncharacterized protein	3.40.630.30	182	11	78	3.54	4.54
	2qecA00	79.34	Corynebacterium glutamicumGCN5-related N-acetyltransferase	3.40.630.30	175	14	77	3.17	4.11
	2ozgA01	79.29	Anabaena variabilis ATCC 29413GCN5-related N-acetyltransferase	3.40.630.30	117	18	69	2.76	3.96
	1qstA00	79.23	HAT A1Tetrahymena thermophila	3.40.630.30	160	4	82	3.53	4.28
	1q2yA00	79.00	Bacillus subtilisUncharacterized N-acetyltransferase yjcF	3.40.630.30	140	11	79	3.16	3.96
	2fl4A02	78.90	Arginine and proline metabolismSpermine/spermidine acetyltransferase, putativeDiamine N-acetyltransferase [EC:2.3.1.57]Metabolic pathwaysEnterococcus faecalis	3.40.630.30	104	11	60	1.94	3.23
	2qmlA00	78.61	BH2621 proteinBacillus halodurans	3.40.630.30	184	14	79	3.39	4.24
	2pr1A00	78.15	Uncharacterized N-acetyltransferase ylbPBacillus subtilis	3.40.630.30	152	7	81	3.33	4.11
	2pdoA01	77.57	Shigella flexneriAcetyltransferase ypeA	3.40.630.30	118	20	69	2.89	4.15
	1xebA00	77.18	Pseudomonas aeruginosaElaA proteinPutative uncharacterized protein	3.40.630.30	146	13	81	3.64	4.49

>pdb|2pc1A00
NLYFQGQIRLAFPNEIDQILLIEEARAEIAKTGSDQWQKEDGYPNRNDIIDDILNGYAWVGIEDGLATYAAVIDGHEEVY
DAIYEGKWLHDNHRYLTFHRIAISNQFRGRGLAQTFLQGLIEGHKGPDFRCDTHEKNVTQHILNKLGYQYCGKVPLDGVR
LAYQKIKEK    

>pdb|2pc1A00
XGSDKIHHHHHHENLYFQGXQIRLAFPNEIDQIXLLIEEARAEIAKTGSDQWQKEDGYPNRNDIIDDILNGYAWVGIEDG
XLATYAAVIDGHEEVYDAIYEGKWLHDNHRYLTFHRIAISNQFRGRGLAQTFLQGLIEGHKGPDFRCDTHEKNVTXQHIL
NKLGYQYCGKVPLDGVRLAYQKIKEKGETSIYREIDERNPX