CATH Domain: 2pbzA03 XML data for domain: 2pbzA03

Molscript image for 2pbzA03
2pbzA03
PDB coordinates for domain 2pbzA03

PDB 2pbz, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1490 Dna Ligase; domain 1
3.30.1490.20 ATP-grasp fold, A domain Gene3D
3.30.1490.20.17
3.30.1490.20.17.1
3.30.1490.20.17.1.1
3.30.1490.20.17.1.1.1
3.30.1490.20.17.1.1.1.1

Segment boundaries for domain 2pbzA03

Chopping figure for domain 2pbzA03
DomainStart PDB ResidueStop PDB Residue
2pbzA01 4 85
2pbzA02 86 113
2pbzA02 168 312
2pbzA03 114 167

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.1490.20.17.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3l4jA02 74.83 Reciprocal meiotic recombinationDNA topoisomerase 2Regulation of mitotic recombinationDNA topoisomerase II [EC:5.99.1.3]DNA strand elongation involved in DNA replication 3.30.1490.30 47 7 55 2.57 4.65
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|2pbzA03
VEVVEPEDAKPDELYFVRIEGSELEERLSPYRVERFIP    

Domain COMBS Sequence

>pdb|2pbzA03
VEVVEPEDAKPDELYFVRIEGPRGGSGHFIVEGSELEERLSTLEEPYRVERFIP    

Domain History Events (71)

Domain assigned by cuff on 17 Apr 2008 12:02

same superfamily

Domain assignment manual match h by cuff on 17 Apr 2008 11:56

same superfamily in scop. nice structural match - query just rather badly resolved

Domain assignment manual match t by tronnberg on 19 Sep 2007 11:12

SSAP: 75.1 OV: 73 SEQ: 7. Reasonable similar linkage and structure. Functionally different.

Homcheck review by tronnberg on 19 Sep 2007 11:12

SSAP: 75.1 OV: 73 SEQ: 7. Reasonable similar linkage and structure. Functionally different.

Flow stage update by tronnberg on 19 Sep 2007 11:12

SSAP: 75.1 OV: 73 SEQ: 7. Reasonable similar linkage and structure. Functionally different.

Homcheck allotment by tronnberg on 19 Sep 2007 11:09

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 19 Sep 2007 11:09

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 20:38

Domain "2pbzA03" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 20:37

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pbzA03

Flow stage update by auto on 15 Sep 2007 16:53

Retrieved PRC_PFAMCATH results for job ID SID5917909136169912 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 16:52

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2pbzA03

Update comment by auto on 15 Sep 2007 09:24

PRC_PFAMCATH job SID5917909136169912 is not yet finished.

Flow stage update by auto on 15 Sep 2007 08:50

The entry "2pbzA03" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 15 Sep 2007 08:50

The entry "2pbzA03" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 02:23

Retrieved SSAP results for job ID SID0260478359431656 and results inserted.

Domain scan ssap cath by auto on 15 Sep 2007 02:21

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 720 results for 2pbzA03

Update comment by auto on 09 Sep 2007 23:16

SSAP job SID0260478359431656 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:36

The entry "2pbzA03" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:36

The entry "2pbzA03" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:07

Giving up on SSAP job SID1934741635923040 because submission time of Wed Sep 5 16:33:33 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:07:51 2007).

Update comment by auto on 05 Sep 2007 19:51

SSAP job SID1934741635923040 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 16:33

The entry "2pbzA03" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 16:33

The entry "2pbzA03" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 12:01

Retrieved PRC results for job ID SID4756771119580039 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 12:00

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2pbzA03

Prc cath submit by auto on 05 Sep 2007 04:17

The entry "2pbzA03" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 04:17

The entry "2pbzA03" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 00:28

Retrieved HMM(SAM) results for job ID SID4863880795835840 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 00:27

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2pbzA03

Update comment by auto on 04 Sep 2007 12:37

HMM(SAM) job SID4863880795835840 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:19

The entry "2pbzA03" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:19

The entry "2pbzA03" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 05:04

Retrieved "2pbzA03" CATHEDRAL results for job ID SID6986843506217568 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 05:03

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 50 results for 2pbzA03

Cathedral cath submit by auto on 03 Sep 2007 14:21

The entry "2pbzA03" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:21

The entry "2pbzA03" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:34

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pbzA03.scanlist" for "2pbzA03"

Write scan list by auto on 03 Sep 2007 12:34

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pbzA03.scanlist" for domain "2pbzA03"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:22

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:15

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:28

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:12

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:15

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:42

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:16

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:33

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:07

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:17

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:12

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:32

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:37

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:16

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:43

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:05

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:24

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:29

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 18:34

Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 14:50

Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 10:15

Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 28 Aug 2007 10:12

No satisfactory AssignClose result found.

Flow stage update by auto on 28 Aug 2007 10:04

No in_process hits for Domain "2pbzA03" ready to be processed

Flow stage update by auto on 28 Aug 2007 10:04

NW result present for Domain "2pbzA03"

Flow stage update by auto on 21 Aug 2007 10:06

All required files are present for Domain "2pbzA03"

Flow stage update by auto on 20 Aug 2007 17:33

Beginning processing for Domain "2pbzA03"

Insertion by cuff on 20 Aug 2007 10:47

nice chopping