Domain assigned by cuff on 09 Apr 2008 15:04
same superfamily
CATH Domain: 2pbeA01
2pbeA01
PDB 2pbe, Chain A, Domain 1
Segment boundaries for domain 2pbeA01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2pbeA01 | 9 | 144 |
| 2pbeA01 | 204 | 214 |
| 2pbeA02 | 145 | 203 |
| 2pbeA02 | 216 | 282 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2pbeA01 DIFLDFALNDERIRLVTLEFQDYDISYFVTDVESFKENDQWLEIFGKRIQKPEDELFPPELGNWFSYIILFEDGNKLDLT LIPIREAEDYFANKVLLDKDSFINYKVNDRQYWIYSFSGKNYKF
Domain History Events (71)
Domain assignment manual match h by cuff on 09 Apr 2008 15:02
nice superposition, similar function, same superfamily in scop
Domain assignment manual match t by tronnberg on 19 Sep 2007 10:45
SSAP: 73.5 OV: 74 SEQ: 9. Reasonable similar linkage and structure. Functionally different.
Homcheck review by tronnberg on 19 Sep 2007 10:45
SSAP: 73.5 OV: 74 SEQ: 9. Reasonable similar linkage and structure. Functionally different.
Flow stage update by tronnberg on 19 Sep 2007 10:45
SSAP: 73.5 OV: 74 SEQ: 9. Reasonable similar linkage and structure. Functionally different.
Homcheck allotment by tronnberg on 19 Sep 2007 10:41
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 19 Sep 2007 10:41
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 15 Sep 2007 20:32
Domain "2pbeA01" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 15 Sep 2007 20:31
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pbeA01
Flow stage update by auto on 15 Sep 2007 16:46
Retrieved PRC_PFAMCATH results for job ID SID3694359331681824 and results inserted.
Domain scan prc pfamcath by auto on 15 Sep 2007 16:45
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 1 results for 2pbeA01
Update comment by auto on 15 Sep 2007 09:24
PRC_PFAMCATH job SID3694359331681824 is not yet finished.
Prc pfamcath submit by auto on 15 Sep 2007 08:49
The entry "2pbeA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 15 Sep 2007 08:49
The entry "2pbeA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 15 Sep 2007 02:12
Retrieved SSAP results for job ID SID2392284700687510 and results inserted.
Domain scan ssap cath by auto on 15 Sep 2007 02:10
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1202 results for 2pbeA01
Update comment by auto on 09 Sep 2007 23:16
SSAP job SID2392284700687510 is not yet finished.
Ssap cath submit by auto on 09 Sep 2007 22:35
The entry "2pbeA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 22:35
The entry "2pbeA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 20:07
Giving up on SSAP job SID2537456435700864 because submission time of Wed Sep 5 16:32:40 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:07:14 2007).
Update comment by auto on 05 Sep 2007 19:51
SSAP job SID2537456435700864 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 16:32
The entry "2pbeA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 16:32
The entry "2pbeA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 11:55
Retrieved PRC results for job ID SID3008444694232288 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 11:54
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2pbeA01
Prc cath submit by auto on 05 Sep 2007 04:16
The entry "2pbeA01" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 04:16
The entry "2pbeA01" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 00:20
Retrieved HMM(SAM) results for job ID SID6326301410868544 and inserted them into the database.
Domain scan sam cath by auto on 05 Sep 2007 00:19
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2pbeA01
Update comment by auto on 04 Sep 2007 12:37
HMM(SAM) job SID6326301410868544 is not yet finished.
Flow stage update by auto on 04 Sep 2007 10:18
The entry "2pbeA01" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 04 Sep 2007 10:18
The entry "2pbeA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 04:57
Retrieved "2pbeA01" CATHEDRAL results for job ID SID0040724112990304 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 04:56
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 360 results for 2pbeA01
Cathedral cath submit by auto on 03 Sep 2007 14:21
The entry "2pbeA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 14:21
The entry "2pbeA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 12:33
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pbeA01.scanlist" for "2pbeA01"
Write scan list by auto on 03 Sep 2007 12:33
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pbeA01.scanlist" for domain "2pbeA01"
Update comment by auto on 03 Sep 2007 10:11
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:31
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:37
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:32
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:22
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:22
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:15
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:28
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:12
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:15
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:17
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:42
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:16
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:33
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:07
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 16:17
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 10:12
Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 06:32
Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 02:37
Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 22:16
Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 14:43
Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 09:05
Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 02:24
Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 22:29
Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 18:34
Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 14:50
Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 10:15
Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 28 Aug 2007 10:12
No satisfactory AssignClose result found.
Flow stage update by auto on 28 Aug 2007 10:04
No in_process hits for Domain "2pbeA01" ready to be processed
Flow stage update by auto on 28 Aug 2007 10:04
NW result present for Domain "2pbeA01"
Flow stage update by auto on 19 Aug 2007 10:12
All required files are present for Domain "2pbeA01"
Flow stage update by auto on 16 Aug 2007 17:14
Beginning processing for Domain "2pbeA01"
Insertion by cuff on 16 Aug 2007 15:45
nice chopping
