CATH Domain: 2pajA01 XML data for domain: 2pajA01

Molscript image for 2pajA01
2pajA01
PDB coordinates for domain 2pajA01

PDB 2paj, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.40 Urease, subunit C; domain 1
2.30.40.10 Urease, subunit C, domain 1 Gene3D
2.30.40.10.14
2.30.40.10.14.1
2.30.40.10.14.1.1
2.30.40.10.14.1.1.1
2.30.40.10.14.1.1.1.1

[top]
Segment boundaries for domain 2pajA01

Chopping figure for domain 2pajA01
DomainStart PDB ResidueStop PDB Residue
2pajA01 10 71
2pajA01 402 458
2pajA02 72 401
2pajA03 459 484

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 2.30.40.10.14.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3feqA01 86.10 2.30.40.10 105 20 82 2.25 2.73
2qs8A01 85.35 2.30.40.10 99 21 81 2.77 3.40
2vhlB01 84.24 Amino sugar and nucleotide sugar metabolismN-acetylglucosamine-6-phosphate deacetylaseBacillus subtilisN-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25] 2.30.40.10 92 22 73 2.49 3.41
3be7A01 83.89 2.30.40.10 95 21 78 2.71 3.47
1gkrA01 81.22 L-hydantoinaseArthrobacter aurescens 2.30.40.10 87 16 68 2.06 2.99
2oodA01 79.34 Bradyrhizobium japonicumGuanine deaminase [EC:3.5.4.3]Purine metabolismBlr3880 proteinMetabolic pathways 2.30.40.10 135 18 82 3.86 4.69
1ejxC01 75.08 Arginine and proline metabolismKlebsiella aerogenesPurine metabolismUrease alpha subunit [EC:3.5.1.5]Atrazine degradation 2.30.40.10 185 13 48 2.09 4.34
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pajA01
PSTLIRNAAAIMTGGRGTADDPSRVPGPDIRIVGDTIDAIGALAPRPGETIVDATDCVIYPAEVGKVAVGYAADIAVYRL
DDPRYFGLHDPAIGPVASGGRPSVMALFSAGKRVVVDDL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pajA01
MSLTTYDTQPSTLIRNAAAIMTGGRGTADDPSRVPGPDIRIVGDTIDAIGALAPRPGETIVDATDCVIYPAEVGKVAVGY
AADIAVYRLDDPRYFGLHDPAIGPVASGGRPSVMALFSAGKRVVVDDL
BLAST against CATH

[top]
Domain History Events (59)

Domain assigned by cuff on 02 Apr 2008 15:35

same superfamily

Domain assignment manual match h by cuff on 02 Apr 2008 15:34

ample evidence for homology

Domain assignment manual match t by tronnberg on 19 Sep 2007 10:23

SSAP: 87.1 OV: 75 SEQ: 18. Very similar linkage and structure (differ with one alfa helix). Functionally different. None of the matches with a assaigened CATH code and a SSAP score above 70 has the same function as the query.

Homcheck review by tronnberg on 19 Sep 2007 10:23

SSAP: 87.1 OV: 75 SEQ: 18. Very similar linkage and structure (differ with one alfa helix). Functionally different. None of the matches with a assaigened CATH code and a SSAP score above 70 has the same function as the query.

Flow stage update by tronnberg on 19 Sep 2007 10:23

SSAP: 87.1 OV: 75 SEQ: 18. Very similar linkage and structure (differ with one alfa helix). Functionally different. None of the matches with a assaigened CATH code and a SSAP score above 70 has the same function as the query.

Homcheck allotment by tronnberg on 19 Sep 2007 10:18

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 19 Sep 2007 10:18

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 20:29

Domain "2pajA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 20:28

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pajA01

Flow stage update by auto on 15 Sep 2007 16:42

Retrieved PRC_PFAMCATH results for job ID SID2023277298174848 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 16:41

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 53 results for 2pajA01

Update comment by auto on 15 Sep 2007 09:23

PRC_PFAMCATH job SID2023277298174848 is not yet finished.

Prc pfamcath submit by auto on 15 Sep 2007 08:49

The entry "2pajA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 08:49

The entry "2pajA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 02:07

Retrieved SSAP results for job ID SID0723807982963040 and results inserted.

Domain scan ssap cath by auto on 15 Sep 2007 02:06

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 818 results for 2pajA01

Update comment by auto on 09 Sep 2007 23:16

SSAP job SID0723807982963040 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:35

The entry "2pajA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:35

The entry "2pajA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:06

Giving up on SSAP job SID1073301326616288 because submission time of Wed Sep 5 16:32:16 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:06:56 2007).

Update comment by auto on 05 Sep 2007 19:51

SSAP job SID1073301326616288 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 16:32

The entry "2pajA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 16:32

The entry "2pajA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 11:51

Retrieved PRC results for job ID SID0572896672870528 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 11:50

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 21 results for 2pajA01

Prc cath submit by auto on 05 Sep 2007 04:15

The entry "2pajA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 04:15

The entry "2pajA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 00:16

Retrieved HMM(SAM) results for job ID SID5995047601792960 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 00:15

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 2pajA01

Update comment by auto on 04 Sep 2007 12:36

HMM(SAM) job SID5995047601792960 is not yet finished.

Flow stage update by auto on 04 Sep 2007 10:18

The entry "2pajA01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Sep 2007 10:18

The entry "2pajA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 04:53

Retrieved "2pajA01" CATHEDRAL results for job ID SID1386537606834940 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 04:52

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 73 results for 2pajA01

Flow stage update by auto on 03 Sep 2007 14:20

The entry "2pajA01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Sep 2007 14:20

The entry "2pajA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:32

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pajA01.scanlist" for "2pajA01"

Write scan list by auto on 03 Sep 2007 12:32

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pajA01.scanlist" for domain "2pajA01"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:22

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:15

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:28

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:12

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:15

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:41

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:16

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:33

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:07

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 31 Aug 2007 20:02

No satisfactory AssignClose result found.

Flow stage update by auto on 31 Aug 2007 19:48

No in_process hits for Domain "2pajA01" ready to be processed

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2pajA01"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2pajA01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2pajA01"

Insertion by cuff on 23 Aug 2007 12:58

nice chopping