CATH Domain: 2p9bA01 XML data for domain: 2p9bA01

Molscript image for 2p9bA01
2p9bA01
PDB coordinates for domain 2p9bA01

PDB 2p9b, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.40 Urease, subunit C; domain 1
2.30.40.10 Urease, subunit C, domain 1 Gene3D
2.30.40.10.5
2.30.40.10.5.1
2.30.40.10.5.1.1
2.30.40.10.5.1.1.1
2.30.40.10.5.1.1.1.1

[top]
Segment boundaries for domain 2p9bA01

Chopping figure for domain 2p9bA01
DomainStart PDB ResidueStop PDB Residue
2p9bA01 9 69
2p9bA01 394 434
2p9bA02 72 163
2p9bA02 371 393
2p9bA03 164 293
2p9bA04 294 370
2p9bA04 435 449

Structural Neighbourhood (16 entries)

There are 16 matching structural neighberhood comparisons for CATH ID 2.30.40.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 16 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3feqA01 88.95 2.30.40.10 105 25 88 1.44 1.63
2qs8A01 88.33 2.30.40.10 99 23 92 2.12 2.30
3be7A01 86.91 2.30.40.10 95 22 89 2.01 2.26
2vhlB01 86.77 Amino sugar and nucleotide sugar metabolismN-acetylglucosamine-6-phosphate deacetylaseBacillus subtilisN-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25] 2.30.40.10 92 21 84 2.16 2.57
2gwnA01 86.25 Pyrimidine metabolismDihydroorotaseDihydroorotase [EC:3.5.2.3]Porphyromonas gingivalisMetabolic pathways 2.30.40.10 96 12 87 2.77 3.18
1rk6A01 86.24 D-aminoacylaseAlcaligenes faecalis 2.30.40.10 87 25 82 2.40 2.92
2qt3A01 85.84 N-isopropylammelide isopropyl amidohydrolasePseudomonas sp. ADP 2.30.40.10 100 21 90 2.91 3.23
1yrrA01 85.13 Amino sugar and nucleotide sugar metabolismEscherichia coli O157:H7N-acetylglucosamine-6-phosphate deacetylaseN-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25] 2.30.40.10 92 27 81 2.35 2.89
2icsA01 84.76 Pyrimidine metabolismDihydroorotase [EC:3.5.2.3]Metabolic pathwaysEnterococcus faecalisPutative uncharacterized protein 2.30.40.10 100 18 81 3.16 3.89
1gkrA01 84.50 L-hydantoinaseArthrobacter aurescens 2.30.40.10 87 29 82 2.81 3.42
2pajA01 84.49 2.30.40.10 119 16 78 2.27 2.90
1gkpA01 84.48 HydrolaseThermus sp. 2.30.40.10 81 25 76 2.30 3.02
2i9uA01 84.34 Cytosine/guanine deaminase related proteinGuanine deaminase [EC:3.5.4.3]Purine metabolismMetabolic pathwaysClostridium acetobutylicum 2.30.40.10 111 18 82 2.37 2.86
1o12A01 82.90 Amino sugar and nucleotide sugar metabolismThermotoga maritimaN-acetylglucosamine-6-phosphate deacetylaseN-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25] 2.30.40.10 72 19 70 3.09 4.40
1kcxA01 81.24 Mus musculusDendriteDihydropyrimidinase-related protein 1Neuronal cell body 2.30.40.10 103 14 67 2.13 3.13
2oodA01 79.28 Bradyrhizobium japonicumGuanine deaminase [EC:3.5.4.3]Purine metabolismBlr3880 proteinMetabolic pathways 2.30.40.10 135 15 71 2.78 3.91
[1]
Displaying entries 1 to 16 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2p9bA01
PIVEPFALAHATIVTGDKAGTILRNTIVVGADGRIEQVAPSIETSIPAEYHYLDGTGKIVSLEVGKSADLLVLNANPLDD
LRALEHPALVIAAGHPVWRPG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2p9bA01
XSLXLSHNPIVEPFALAHATIVTGDKAGTILRNXTIVVGADGRIEQVAPSIETSIPAEYHYLDGTGKIVSLEVGKSADLL
VLNANPLDDLRALEHPALVIAAGHPVWRPG
BLAST against CATH

[top]
Domain History Events (56)

Domain assigned by cuff on 14 Apr 2008 12:21

same superfamily

Domain assignment manual match h by cuff on 14 Apr 2008 12:20

same superfamily in scop, great structural match, same function. how can this not be homolgous?

Homcheck review by tronnberg on 19 Sep 2007 09:30

SSAP: 86.5 OV: 83 SEQ: 21. Very similar linkage and structure. Functionally different. None of the matches on the scan list with a SSAP score above 70 has the same function as the query.

Flow stage update by tronnberg on 19 Sep 2007 09:30

SSAP: 86.5 OV: 83 SEQ: 21. Very similar linkage and structure. Functionally different. None of the matches on the scan list with a SSAP score above 70 has the same function as the query.

Domain assignment manual match t by tronnberg on 19 Sep 2007 09:30

SSAP: 86.5 OV: 83 SEQ: 21. Very similar linkage and structure. Functionally different. None of the matches on the scan list with a SSAP score above 70 has the same function as the query.

Homcheck allotment by tronnberg on 19 Sep 2007 09:25

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 19 Sep 2007 09:25

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 20:22

Domain "2p9bA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 20:21

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2p9bA01

Flow stage update by auto on 15 Sep 2007 16:35

Retrieved PRC_PFAMCATH results for job ID SID5359482467155635 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 16:34

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 32 results for 2p9bA01

Update comment by auto on 15 Sep 2007 09:23

PRC_PFAMCATH job SID5359482467155635 is not yet finished.

Prc pfamcath submit by auto on 15 Sep 2007 08:48

The entry "2p9bA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 08:48

The entry "2p9bA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 01:53

Retrieved SSAP results for job ID SID0357423667883968 and results inserted.

Domain scan ssap cath by auto on 15 Sep 2007 01:52

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 887 results for 2p9bA01

Update comment by auto on 09 Sep 2007 23:15

SSAP job SID0357423667883968 is not yet finished.

Flow stage update by auto on 09 Sep 2007 22:34

The entry "2p9bA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 09 Sep 2007 22:34

The entry "2p9bA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:06

Giving up on SSAP job SID9387237707330640 because submission time of Wed Sep 5 16:31:25 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:06:18 2007).

Update comment by auto on 05 Sep 2007 19:50

SSAP job SID9387237707330640 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 16:31

The entry "2p9bA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 16:31

The entry "2p9bA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 11:45

Retrieved PRC results for job ID SID8162901941805504 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 11:44

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 9 results for 2p9bA01

Prc cath submit by auto on 05 Sep 2007 04:14

The entry "2p9bA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 04:14

The entry "2p9bA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 00:09

Retrieved HMM(SAM) results for job ID SID2589725585094784 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 00:08

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 4 results for 2p9bA01

Update comment by auto on 04 Sep 2007 12:36

HMM(SAM) job SID2589725585094784 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:17

The entry "2p9bA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:17

The entry "2p9bA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 04:46

Retrieved "2p9bA01" CATHEDRAL results for job ID SID1098819898914544 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 04:45

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 33 results for 2p9bA01

Flow stage update by auto on 03 Sep 2007 14:20

The entry "2p9bA01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Sep 2007 14:20

The entry "2p9bA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:31

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2p9bA01.scanlist" for "2p9bA01"

Write scan list by auto on 03 Sep 2007 12:30

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2p9bA01.scanlist" for domain "2p9bA01"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:22

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:15

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:28

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:12

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:15

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:41

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Sep 2007 10:28

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Sep 2007 10:10

No in_process hits for Domain "2p9bA01" ready to be processed

Flow stage update by auto on 01 Sep 2007 10:10

NW result present for Domain "2p9bA01"

Flow stage update by auto on 30 Aug 2007 10:04

All required files are present for Domain "2p9bA01"

Flow stage update by auto on 29 Aug 2007 14:34

Beginning processing for Domain "2p9bA01"

Insertion by cuff on 29 Aug 2007 11:17

nice chopping