CATH Domain: 2p97A00 XML data for domain: 2p97A00

Molscript image for 2p97A00
2p97A00
PDB coordinates for domain 2p97A00

PDB 2p97, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.60 4-Layer Sandwich
3.60.15 Metallo-beta-lactamase; Chain A
3.60.15.10 Metallo-beta-lactamase, chain A Gene3D
3.60.15.10.13
3.60.15.10.13.1
3.60.15.10.13.1.1
3.60.15.10.13.1.1.1
3.60.15.10.13.1.1.1.1

[top]
Segment boundaries for domain 2p97A00

Chopping figure for domain 2p97A00
DomainStart PDB ResidueStop PDB Residue
2p97A00 0 200

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.60.15.10.13.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1e5dA02 78.01 Desulfovibrio gigasRubredoxin-oxygen oxidoreductase 3.60.15.10 247 11 78 2.94 3.72
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2p97A00
GKSLHRPDLYSWSTFNPARNIDFNGFAWIRPEGNILIDPVALSNHDWKHLESLGGVVWIVLTNSDHVRSAKEIADQTYTK
IAGPVAEKENFPIYCDRWLSDGDELVPGLKVELQGSKTPGELALLLEETTLITGDLVRAYRAGGLEILPDEKLNKQKVVA
SVRRLAALEKVEAVLVGDGWSVFRDGRDRLKELVATLA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2p97A00
GXKSLHRPDLYSWSTFNPARNIDFNGFAWIRPEGNILIDPVALSNHDWKHLESLGGVVWIVLTNSDHVRSAKEIADQTYT
KIAGPVAEKENFPIYCDRWLSDGDELVPGLKVXELQGSKTPGELALLLEETTLITGDLVRAYRAGGLEILPDEKLXNKQK
VVASVRRLAALEKVEAVLVGDGWSVFRDGRDRLKELVATLA
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 09 Apr 2008 17:13

Assigning to "3.60.15.10" based on similarity with "2p97B00"

Flow stage update by auto on 09 Apr 2008 17:05

No in_process hits for Domain "2p97A00" ready to be processed

Update comment by auto on 03 Sep 2007 20:10

Domain "2p97A00" hits Domain "2p97B00" (98.5074626865672% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2p97A00" hits Domain "2p97B00" (98.5074626865672% over 100%) which is currently in process

Update comment by auto on 31 Aug 2007 19:49

Domain "2p97A00" hits Domain "2p97B00" (98.5074626865672% over 100%) which is currently in process

Flow stage update by auto on 31 Aug 2007 19:48

Domain "2p97A00" hits Domain "2p97B00" (98.5074626865672% over 100%) which is currently in process

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2p97A00"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2p97A00"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2p97A00"

Insertion by auto on 23 Aug 2007 14:11

Final ChopClose added based on similarity with "2p97B"