Domain assigned by cuff on 09 Apr 2008 15:42
same superfamily
CATH Domain: 2p8tA02
2p8tA02
PDB 2p8t, Chain A, Domain 2
| CATH Code | Level Description | Links |
|---|---|---|
 3
| Alpha Beta | |
 3.30
| 2-Layer Sandwich | |
 3.30.1360
| Gyrase A; domain 2 | |
 3.30.1360.30
| Gene3D | |
 3.30.1360.30.2
| ||
 3.30.1360.30.2.1
| ||
 3.30.1360.30.2.1.1
| ||
 3.30.1360.30.2.1.1.1
| ||
 3.30.1360.30.2.1.1.1.1
|
Segment boundaries for domain 2p8tA02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2p8tA01 | 14 | 82 |
| 2p8tA01 | 192 | 199 |
| 2p8tA02 | 83 | 191 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2p8tA02 MFSEPIGVSVDGYPGIAIVVKNPPEFKSIELRDEAIKFDAKGAMILTVKDNEIVFPEDFRPLKEMYPEVAKKIVDYEDGD AVIITWAETPAKALKSAIHVAYILKKEEI
Domain History Events (59)
Domain assignment manual match h by cuff on 09 Apr 2008 15:41
nice structural match, same superfamily in scop
Domain assignment manual match t by tronnberg on 18 Sep 2007 16:00
SSAP: 79.8 OV: 76 SEQ: 12. Similar linkage and straucture. The query's function is unknown.
Homcheck review by tronnberg on 18 Sep 2007 16:00
SSAP: 79.8 OV: 76 SEQ: 12. Similar linkage and straucture. The query's function is unknown.
Flow stage update by tronnberg on 18 Sep 2007 16:00
SSAP: 79.8 OV: 76 SEQ: 12. Similar linkage and straucture. The query's function is unknown.
Homcheck allotment by tronnberg on 18 Sep 2007 15:57
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 18 Sep 2007 15:57
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 15 Sep 2007 20:21
Domain "2p8tA02" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 15 Sep 2007 20:20
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2p8tA02
Flow stage update by auto on 15 Sep 2007 16:34
Retrieved PRC_PFAMCATH results for job ID SID0868432570025496 and results inserted.
Domain scan prc pfamcath by auto on 15 Sep 2007 16:32
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2p8tA02
Update comment by auto on 15 Sep 2007 09:23
PRC_PFAMCATH job SID0868432570025496 is not yet finished.
Prc pfamcath submit by auto on 15 Sep 2007 08:48
The entry "2p8tA02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 15 Sep 2007 08:48
The entry "2p8tA02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 15 Sep 2007 01:52
Retrieved SSAP results for job ID SID8194930485063689 and results inserted.
Domain scan ssap cath by auto on 15 Sep 2007 01:45
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 3596 results for 2p8tA02
Update comment by auto on 09 Sep 2007 23:15
SSAP job SID8194930485063689 is not yet finished.
Flow stage update by auto on 09 Sep 2007 22:34
The entry "2p8tA02" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 09 Sep 2007 22:34
The entry "2p8tA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 20:06
Giving up on SSAP job SID5310339886074048 because submission time of Wed Sep 5 16:31:16 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:06:12 2007).
Update comment by auto on 05 Sep 2007 19:50
SSAP job SID5310339886074048 is not yet finished.
Flow stage update by auto on 05 Sep 2007 16:31
The entry "2p8tA02" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 05 Sep 2007 16:31
The entry "2p8tA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 11:44
Retrieved PRC results for job ID SID0113804635478768 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 11:43
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2p8tA02
Prc cath submit by auto on 05 Sep 2007 04:14
The entry "2p8tA02" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 04:14
The entry "2p8tA02" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 00:08
Retrieved HMM(SAM) results for job ID SID5215746671927264 and inserted them into the database.
Domain scan sam cath by auto on 05 Sep 2007 00:07
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2p8tA02
Update comment by auto on 04 Sep 2007 12:35
HMM(SAM) job SID5215746671927264 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 10:17
The entry "2p8tA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 10:17
The entry "2p8tA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 04:45
Retrieved "2p8tA02" CATHEDRAL results for job ID SID1889389885739200 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 04:44
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 212 results for 2p8tA02
Flow stage update by auto on 03 Sep 2007 14:19
The entry "2p8tA02" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 03 Sep 2007 14:19
The entry "2p8tA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 12:30
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2p8tA02.scanlist" for "2p8tA02"
Write scan list by auto on 03 Sep 2007 12:30
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2p8tA02.scanlist" for domain "2p8tA02"
Update comment by auto on 03 Sep 2007 10:11
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:31
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:37
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:32
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:22
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:22
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:15
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:28
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:12
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:15
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:17
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:41
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:16
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:33
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:07
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Flow stage update by auto on 31 Aug 2007 20:02
No satisfactory AssignClose result found.
Flow stage update by auto on 31 Aug 2007 19:48
No in_process hits for Domain "2p8tA02" ready to be processed
Flow stage update by auto on 31 Aug 2007 19:48
NW result present for Domain "2p8tA02"
Flow stage update by auto on 24 Aug 2007 10:06
All required files are present for Domain "2p8tA02"
Flow stage update by auto on 23 Aug 2007 18:40
Beginning processing for Domain "2p8tA02"
Insertion by cuff on 23 Aug 2007 12:19
nice chopping
