CATH Domain: 2p8tA01 XML data for domain: 2p8tA01

Molscript image for 2p8tA01
2p8tA01
PDB coordinates for domain 2p8tA01

PDB 2p8t, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.10 Arc Repressor Mutant, subunit A
1.10.10.10 "winged helix" repressor DNA binding domain Gene3D
1.10.10.10.28
1.10.10.10.28.1
1.10.10.10.28.1.1
1.10.10.10.28.1.1.1
1.10.10.10.28.1.1.1.1

[top]
Segment boundaries for domain 2p8tA01

Chopping figure for domain 2p8tA01
DomainStart PDB ResidueStop PDB Residue
2p8tA01 14 82
2p8tA01 192 199
2p8tA02 83 191

Structural Neighbourhood (86 entries)

There are 86 matching structural neighberhood comparisons for CATH ID 1.10.10.10.28.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 86 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1yg2A01 88.89 Vibrio cholerae pathogenic cycleVibrio choleraePadR family transcriptional regulator, regulatory protein AphAPutative uncharacterized protein 1.10.10.10 79 10 86 4.01 4.66
2dtrA01 88.56 DtxR family transcriptional regulator, Mn-dependent transcriptional regulatorDiphtheria toxin repressorCorynebacterium diphtheriae 1.10.10.10 71 14 82 2.10 2.54
1z05A01 88.40 Vibrio choleraeTranscriptional regulator, ROK family 1.10.10.10 72 16 74 1.96 2.62
2g7uA01 88.03 Rhodococcus opacusPutative regulator of catechol degradative operon 1.10.10.10 74 16 86 2.75 3.17
2fnaA03 88.00 Sulfolobus solfataricusPutative uncharacterized protein 1.10.10.10 72 12 84 2.28 2.71
2o0yB01 87.32 Rhodococcus jostii RHA1Transcriptional regulator 1.10.10.10 64 15 74 1.86 2.49
2ia2C01 87.13 Rhodococcus sp. DK17PcaR 1.10.10.10 60 18 73 1.87 2.55
1lvaA03 86.85 Selenocysteine-specific elongation factorSelenocysteine-specific elongation factorMoorella thermoacetica 1.10.10.10 62 11 72 2.20 3.06
1qbjC00 86.75 CytoplasmNucleolusHomo sapiensDouble-stranded RNA-specific adenosine deaminaseBase conversion or substitution editing 1.10.10.10 66 7 74 2.01 2.69
2ia2D01 86.70 Rhodococcus sp. DK17PcaR 1.10.10.10 57 19 70 1.92 2.72
2o0yC01 86.55 Rhodococcus jostii RHA1Transcriptional regulator 1.10.10.10 73 13 72 1.88 2.61
1sfuA00 86.45 Yaba-like disease virus34L protein 1.10.10.10 70 14 77 2.48 3.21
2heoA00 86.44 Mus musculusLeft-handed Z-DNA bindingZ-DNA-binding protein 1 1.10.10.10 59 11 70 1.45 2.05
1s3jA02 86.34 Bacillus subtilisUncharacterized HTH-type transcriptional regulator yusO 1.10.10.10 62 22 68 1.60 2.35
1dpuA00 85.85 DNA-dependent DNA replicationReplication protein A 32 kDa subunitNucleotide excision repairDNA replicationReplication factor A2 1.10.10.10 69 17 77 3.38 4.37
1t6sB02 85.82 Chlorobaculum tepidumSegregation and condensation protein BSegregation and condensation protein B 1.10.10.10 77 9 79 2.47 3.12
1j5yA01 85.79 Thermotoga maritimaTranscriptional regulator, biotin repressor family 1.10.10.10 64 18 76 2.71 3.57
1ldjA06 85.71 Cullin-1Cell cycle arrestInduction of apoptosis by intracellular signalsUbiquitin mediated proteolysisWnt signaling pathway 1.10.10.10 68 7 68 1.28 1.88
2hoeA01 85.57 Thermotoga maritimaTranscriptional regulator, XylR-related 1.10.10.10 57 14 65 0.90 1.38
1w1wE00 85.44 Nuclear mitotic cohesin complexProtein acetylationChromatin bindingCohesin complex subunit SCC1Establishment of mitotic sister chromatid cohesion 1.10.10.580 70 7 78 2.35 2.99
1lvaA01 85.43 Selenocysteine-specific elongation factorSelenocysteine-specific elongation factorMoorella thermoacetica 1.10.10.10 59 11 66 1.52 2.28
1ft9A02 85.36 Rhodospirillum rubrumCooA protein 1.10.10.10 79 6 77 2.24 2.90
2hr3D02 85.05 Probable transcriptional regulatorPseudomonas aeruginosa 1.10.10.10 61 13 70 2.01 2.84
3cuqB03 84.99 Homo sapiensVacuolar protein-sorting-associated protein 36ESCRT-II complex subunit VPS36Endocytosis 1.10.10.10 69 7 80 2.78 3.48
1hstA00 84.96 Histone H1/5Gallus gallusHistone H5 1.10.10.10 74 6 73 2.46 3.35
1lvaA02 84.92 Selenocysteine-specific elongation factorSelenocysteine-specific elongation factorMoorella thermoacetica 1.10.10.10 69 18 73 2.27 3.10
1lvaA04 84.67 Selenocysteine-specific elongation factorSelenocysteine-specific elongation factorMoorella thermoacetica 1.10.10.10 60 16 74 2.27 3.04
2jt1A00 84.52 PefI proteinSalmonella enterica subsp. enterica serovar Typhimurium 1.10.10.10 71 15 73 2.31 3.15
1cf7A00 84.46 Protein domain specific bindingTranscription factor bindingE2F transcription factor 4/5Transcription factor E2F4TGF-beta signaling pathway 1.10.10.10 67 13 73 1.93 2.63
1p6rA00 84.43 Bacillus licheniformisPenicillinase repressor 1.10.10.10 82 9 80 3.87 4.81
1biaA01 83.93 Biotin metabolismDNA bindingBirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]Bifunctional protein birABiotin-[acetyl-CoA-carboxylase] ligase activity 1.10.10.10 64 17 77 3.39 4.38
1hw5A02 83.80 TranscriptionTranscription activator activityTranscription repressor activityCRP/FNR family transcriptional regulator, cyclic AMP receptor proteinCatabolite gene activator 1.10.10.10 68 10 68 1.84 2.71
1jhfA02 83.68 Repressor LexA [EC:3.4.21.88]TranscriptionDNA bindingLexA repressorTranscription repressor activity 1.10.10.10 69 17 74 3.68 4.93
1cf7B00 83.63 Protein domain specific bindingTranscription factor Dp-2Transcription cofactor activityHomo sapiens 1.10.10.10 82 9 70 2.27 3.21
3bwgB01 83.57 GntR family transcriptional regulator, transcriptional regulator of bglABacillus subtilisUncharacterized HTH-type transcriptional regulator yydK 1.10.10.10 68 8 76 2.61 3.43
1o57A01 83.38 Pur operon repressorBacillus subtilisPurine operon repressor 1.10.10.10 72 11 74 2.79 3.74
1ku9A01 83.33 DNA-binding protein MJ1563Methanocaldococcus jannaschii 1.10.10.10 83 21 63 3.08 4.82
1u5tB02 83.18 Protein targeting to vacuoleVacuolar protein-sorting-associated protein 36Protein retention in Golgi apparatusUbiquitin bindingEndocytosis 1.10.10.10 69 5 72 2.27 3.15
2w25A01 83.11 Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory proteinLeucine-responsive regulatory proteinMycobacterium tuberculosis 1.10.10.10 52 11 66 3.08 4.62
3by6C01 83.08 GntR family transcriptional regulatorOenococcus oeni PSU-1Transcriptional regulator, GntR family 1.10.10.10 77 10 72 3.06 4.21
2r3sB01 82.79 1.10.10.10 76 12 68 2.31 3.38
1oyiA00 82.66 Vaccinia virusDouble-stranded RNA-binding protein 1.10.10.10 62 17 70 1.95 2.76
2hs5A01 82.65 Rhodococcus jostii RHA1Probable transcriptional regulator, GntR family protein 1.10.10.10 67 13 74 2.73 3.66
1aoyA00 82.36 Transcriptional regulator of arginine metabolismArginine repressorEscherichia coli K-12Plasmid recombination 1.10.10.10 78 16 75 3.39 4.48
2p5vA01 81.87 Neisseria meningitidis serogroup BTranscriptional regulator, AsnC familyLrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein 1.10.10.10 52 21 66 3.03 4.54
1lddA00 81.83 Mitotic sister chromatid segregationProtein ubiquitinationCyclin catabolic processMeiosis - yeastAnaphase-promoting complex subunit 2 1.10.10.10 74 8 73 2.09 2.85
1bbyA00 81.63 Basal transcription factorsGeneral transcription factor IIF subunit 2General RNA polymerase II transcription factor activityHomo sapiensTranscription initiation factor TFIIF beta subunit 1.10.10.10 69 4 76 2.74 3.61
3h92A00 81.60 Methanocaldococcus jannaschiiUncharacterized ATP-binding protein MJECL15 1.10.10.10 85 13 64 1.91 2.95
2jtvA00 81.58 Rhodopseudomonas palustrisPutative uncharacterized protein 1.10.10.10 65 9 73 2.73 3.72
1yioA02 81.54 Response regulatory proteinPseudomonas fluorescens 1.10.10.10 59 18 77 3.64 4.71
1pufB00 81.23 CytoplasmPre-B-cell leukemia transcription factor 1Transcription factor bindingPre-B-cell leukemia transcription factorNucleus 1.10.10.60 73 4 78 3.79 4.82
2dt5B01 81.22 Thermus thermophilus HB8Redox-sensing transcriptional repressor rexAT-rich DNA-binding protein 1.10.10.10 73 12 77 3.36 4.34
1k78A01 81.18 Paired box protein Pax-5Transcription from RNA polymerase II promoterOrgan morphogenesisPaired box protein 2/5Homo sapiens 1.10.10.10 66 12 65 2.23 3.41
3dfgA01 81.02 Xanthomonas campestris pv. campestrisRegulatory proteinRegulatory protein recX 1.10.10.10 48 10 58 2.18 3.72
3cuqA02 81.00 ESCRT-II complex subunit VPS22Transcription factor bindingRegulation of transcription from RNA polymerase II promoterHomo sapiensVacuolar-sorting protein SNF8 1.10.10.10 81 6 67 2.50 3.68
1b4aA01 80.54 Geobacillus stearothermophilusArginine repressor 1.10.10.10 59 6 60 1.86 3.10
1xd7A00 80.03 Bacillus subtilisPutative HTH-type transcriptional regulator ywnA 1.10.10.10 116 18 59 2.22 3.73
1xb4B02 79.55 Protein targeting to vacuoleESCRT-II complex subunit VPS25Saccharomyces cerevisiaeESCRT II complexVacuolar protein-sorting-associated protein 25 1.10.10.10 75 8 72 2.66 3.69
1fjlC00 79.48 Transcription activator activitySequence-specific DNA bindingSegmentation protein pairedDrosophila melanogasterPositive regulation of transcription, DNA-dependent 1.10.10.60 59 6 62 3.03 4.84
1tc3C00 79.17 Caenorhabditis elegansTransposable element Tc3 transposase 1.10.10.60 51 5 60 2.42 4.03
1d8jA00 79.14 Basal transcription factorsTranscription initiation factor IIE subunit betaTranscription initiation factor TFIIE beta subunitHomo sapiensProtein binding 1.10.10.10 81 12 75 3.35 4.45
1vm0A00 78.68 Arabidopsis thalianaUncharacterized protein At2g34160 3.30.110.20 89 9 64 2.87 4.48
2hddB00 78.67 Trunk segmentationImaginal disc-derived female genitalia developmentDrosophila melanogasterImaginal disc-derived male genitalia developmentProtein binding 1.10.10.60 56 14 61 2.89 4.71
1bobA03 78.54 Chromatin silencing at telomereHistone acetyltransferase 1 [EC:2.3.1.48]Histone acetyltransferase type B catalytic subunitHistone acetyltransferase activityProtein binding 1.10.10.390 54 14 58 2.85 4.86
1w0uA00 78.46 Protein homodimerization activityTelomeric repeat-binding factor 2Protein C-terminus bindingTelomeric loop formationProtection from non-homologous end joining at telomere 1.10.10.60 55 14 62 2.78 4.44
1ldjA07 78.34 Cullin-1Cell cycle arrestInduction of apoptosis by intracellular signalsUbiquitin mediated proteolysisWnt signaling pathway 1.10.10.10 105 6 53 2.07 3.88
1gvdA00 77.86 Transcriptional activator MybNucleusEmbryonic digestive tract developmentProtein bindingMus musculus 1.10.10.60 52 15 58 2.22 3.78
1e3oC02 77.75 POU domain transcription factor, class 2POU domain, class 2, transcription factor 1Protein bindingSequence-specific DNA binding transcription factor activityNegative regulation of transcription, DNA-dependent 1.10.10.60 48 12 53 2.23 4.18
1fp1D01 77.69 Medicago sativaIsoliquiritigenin 2'-O-methyltransferase 1.10.10.10 105 12 57 2.64 4.62
1ic8A02 77.49 Promoter bindingProtein homodimerization activityNucleusPositive regulation of transcription, DNA-dependentGlucose homeostasis 1.10.10.60 74 5 61 2.77 4.52
1s6lA01 77.16 Alkylmercury lyaseEscherichia coli 1.10.10.10 52 11 66 3.02 4.53
1w0tA00 77.09 Protein homooligomerizationPositive regulation of mitotic cell cycleTelomere maintenance via telomere shorteningNegative regulation of telomerase activityG2/M transition of mitotic cell cycle 1.10.10.60 52 7 58 2.49 4.24
2k9nA02 77.00 MYB24Trichomonas vaginalis 1.10.10.60 54 11 68 3.30 4.85
1k78I00 76.59 Paired box protein Pax-5Transcription from RNA polymerase II promoterOrgan morphogenesisPaired box protein 2/5Homo sapiens 1.10.10.10 58 13 57 2.65 4.62
1ng6A02 76.27 Hypothetical proteinBacillus subtilisUncharacterized protein yqeY 1.10.10.410 57 8 57 2.73 4.76
3c18A03 76.07 Exiguobacterium sibiricum 255-15Putative uncharacterized protein 1.10.10.10 54 16 54 2.17 3.97
1t56A01 75.98 TRANSCRIPTIONAL REGULATORY REPRESSOR PROTEIN (TETR-FAMILY) ETHRMycobacterium tuberculosis 1.10.10.60 46 4 50 2.31 4.56
1gv2A02 75.67 Transcriptional activator MybNucleusEmbryonic digestive tract developmentProtein bindingMus musculus 1.10.10.60 46 8 58 2.50 4.26
2ga1A02 75.61 Anabaena variabilis ATCC 29413Putative uncharacterized protein 1.10.10.10 67 5 68 3.29 4.84
2hyjA01 75.30 Streptomyces coelicolorPutative tetR-family transcriptional regulator 1.10.10.60 46 10 50 2.51 4.95
2raeA01 75.10 Rhodococcus jostii RHA1Transcriptional regulator, AcrR family protein 1.10.10.60 43 9 52 2.41 4.63
1ldkB03 74.89 Cullin-1Cell cycle arrestInduction of apoptosis by intracellular signalsUbiquitin mediated proteolysisWnt signaling pathway 1.10.10.10 83 6 62 2.84 4.53
1tt5B02 74.22 Protein heterodimerization activityNucleusUbiquitin-activating enzyme E1 C [EC:6.3.2.19]Homo sapiensNEDD8-activating enzyme E1 catalytic subunit 1.10.10.520 77 4 53 2.53 4.75
3ccyA01 73.88 Bordetella parapertussisPutative TetR-family transcriptional regulator 1.10.10.60 44 6 49 2.22 4.50
1fexA00 73.45 Protein bindingTelomeric repeat-binding factor 2-interacting protein 1Protection from non-homologous end joining at telomereNegative regulation of telomere maintenanceCytoplasm 1.10.10.60 59 15 57 2.33 4.06
2hxiA01 73.42 Putative transcriptional regulatorStreptomyces coelicolor 1.10.10.60 63 15 68 3.38 4.97
[1]
Displaying entries 1 to 86 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2p8tA01
EYTVEDVLAVIFLLKEPLGRKQISERLELGEGSVRTLLRKLSHLDIIRSKGHFLTLKGKEIRDKLLSTPEILEVV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2p8tA01
MVGQVIRKRGAYPEYTVEDVLAVIFLLKEPLGRKQISERLELGEGSVRTLLRKLSHLDIIRSKQRGHFLTLKGKEIRDKL
LSTPEILEVVK
BLAST against CATH

[top]
Domain History Events (59)

Domain assigned by cuff on 02 Apr 2008 15:26

same superfamily

Domain assignment manual match h by cuff on 02 Apr 2008 15:23

ample evidence for homology

Domain assignment manual match t by tronnberg on 18 Sep 2007 15:56

SSAP: 87.7 OV: 84 SEQ: 23. Very similar linkage and structure. the query's function is unknown.

Homcheck review by tronnberg on 18 Sep 2007 15:56

SSAP: 87.7 OV: 84 SEQ: 23. Very similar linkage and structure. the query's function is unknown.

Flow stage update by tronnberg on 18 Sep 2007 15:56

SSAP: 87.7 OV: 84 SEQ: 23. Very similar linkage and structure. the query's function is unknown.

Homcheck allotment by tronnberg on 18 Sep 2007 15:53

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 18 Sep 2007 15:53

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 20:20

Domain "2p8tA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 20:19

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2p8tA01

Flow stage update by auto on 15 Sep 2007 16:32

Retrieved PRC_PFAMCATH results for job ID SID1641614332860128 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 16:31

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 471 results for 2p8tA01

Update comment by auto on 15 Sep 2007 09:23

PRC_PFAMCATH job SID1641614332860128 is not yet finished.

Prc pfamcath submit by auto on 15 Sep 2007 08:48

The entry "2p8tA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 08:48

The entry "2p8tA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 01:45

Retrieved SSAP results for job ID SID0207931552334376 and results inserted.

Domain scan ssap cath by auto on 15 Sep 2007 01:38

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2792 results for 2p8tA01

Update comment by auto on 09 Sep 2007 23:15

SSAP job SID0207931552334376 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:34

The entry "2p8tA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:34

The entry "2p8tA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:06

Giving up on SSAP job SID5957303542815200 because submission time of Wed Sep 5 16:31:07 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:06:06 2007).

Update comment by auto on 05 Sep 2007 19:50

SSAP job SID5957303542815200 is not yet finished.

Flow stage update by auto on 05 Sep 2007 16:31

The entry "2p8tA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 16:31

The entry "2p8tA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 11:43

Retrieved PRC results for job ID SID0200285832547878 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 11:42

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 26 results for 2p8tA01

Prc cath submit by auto on 05 Sep 2007 04:14

The entry "2p8tA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 04:14

The entry "2p8tA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 00:07

Retrieved HMM(SAM) results for job ID SID6478635490469408 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 00:06

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2p8tA01

Update comment by auto on 04 Sep 2007 12:35

HMM(SAM) job SID6478635490469408 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:17

The entry "2p8tA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:17

The entry "2p8tA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 04:44

Retrieved "2p8tA01" CATHEDRAL results for job ID SID3989432996495072 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 04:43

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 68 results for 2p8tA01

Flow stage update by auto on 03 Sep 2007 14:19

The entry "2p8tA01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Sep 2007 14:19

The entry "2p8tA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:30

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2p8tA01.scanlist" for "2p8tA01"

Write scan list by auto on 03 Sep 2007 12:30

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2p8tA01.scanlist" for domain "2p8tA01"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:22

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:15

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:28

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:12

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:15

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:41

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:16

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:33

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:07

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 31 Aug 2007 20:02

No satisfactory AssignClose result found.

Flow stage update by auto on 31 Aug 2007 19:48

No in_process hits for Domain "2p8tA01" ready to be processed

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2p8tA01"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2p8tA01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2p8tA01"

Insertion by cuff on 23 Aug 2007 12:19

nice chopping