CATH Domain: 2p8iC00 XML data for domain: 2p8iC00

Molscript image for 2p8iC00
2p8iC00
PDB coordinates for domain 2p8iC00

PDB 2p8i, Chain C, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.70 Alpha-Beta Plaits
3.30.70.1240 DOPA-like domains Gene3D
3.30.70.1240.1
3.30.70.1240.1.1
3.30.70.1240.1.1.1
3.30.70.1240.1.1.1.1
3.30.70.1240.1.1.1.1.1

[top]
Segment boundaries for domain 2p8iC00

Chopping figure for domain 2p8iC00
DomainStart PDB ResidueStop PDB Residue
2p8iC00 0 115

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.70.1240.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vlyA02 72.09 RNA modificationTRNA-modifying protein ygfZFolic acid bindingEscherichia coli K-12 3.30.70.1400 84 7 55 2.55 4.60
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2p8iC00
GTFRDTSAIASWHAHVYFDASSRDAAWTLREQIEAHWSGKLQLGRFHERPVGPHPWSYQLAFTQEQFADLVGWLTLNHGA
LDIFLHPNTGDALRDHRDAAVWIGHSHELVLSAL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2p8iC00
GXTFRDTSAIASWHAHVYFDASSRDAAWTLREQIEAHWSGKLQLGRFHERPVGPHPXWSYQLAFTQEQFADLVGWLTLNH
GALDIFLHPNTGDALRDHRDAAVWIGHSHELVLSALN
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 15 Feb 2008 14:24

Assigning to "3.30.70.1240" based on similarity with "2nyhA00"

Flow stage update by auto on 15 Feb 2008 14:17

No in_process hits for Domain "2p8iC00" ready to be processed

Update comment by auto on 15 Feb 2008 14:04

Domain "2p8iC00" hits Domain "2nyhB00" (98.2905982905983% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2p8iC00" hits Domain "2nyhA00" (98.2905982905983% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2p8iC00" hits Domain "2nyhA00" (98.2905982905983% over 100%) which is currently in process

Update comment by auto on 28 Aug 2007 10:05

Domain "2p8iC00" hits Domain "2nyhA00" (98.2905982905983% over 100%) which is currently in process

Flow stage update by auto on 28 Aug 2007 10:04

Domain "2p8iC00" hits Domain "2nyhA00" (98.2905982905983% over 100%) which is currently in process

Flow stage update by auto on 28 Aug 2007 10:04

NW result present for Domain "2p8iC00"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2p8iC00"

Flow stage update by auto on 16 Aug 2007 17:14

Beginning processing for Domain "2p8iC00"

Insertion by auto on 16 Aug 2007 15:00

Final ChopClose added based on similarity with "2nyhA"