CATH Domain: 2p7iA00 XML data for domain: 2p7iA00

Molscript image for 2p7iA00
2p7iA00
PDB coordinates for domain 2p7iA00

PDB 2p7i, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.150 Vaccinia Virus protein VP39 Gene3D
3.40.50.150.11
3.40.50.150.11.1
3.40.50.150.11.1.1
3.40.50.150.11.1.1.1
3.40.50.150.11.1.1.1.1

[top]
Segment boundaries for domain 2p7iA00

Chopping figure for domain 2p7iA00
DomainStart PDB ResidueStop PDB Residue
2p7iA00 22 246

Structural Neighbourhood (15 entries)

There are 15 matching structural neighberhood comparisons for CATH ID 3.40.50.150.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 15 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vlmA00 81.52 Thermotoga maritimaPutative uncharacterized protein 3.40.50.150 202 17 84 2.85 3.39
2r3sA03 80.88 3.40.50.150 202 13 78 3.15 4.01
3bxoA01 79.54 Streptomyces venezuelaeN,N-dimethyltransferase 3.40.50.150 177 14 68 2.74 3.99
3cggA00 79.21 SAM-dependent methyltransferasesCorynebacterium glutamicum 3.40.50.150 184 11 71 3.32 4.64
1xvaA02 79.12 S-adenosylhomocysteine metabolic processRattus norvegicusNucleusGlycine, serine and threonine metabolismGlycine N-methyltransferase activity 3.40.50.150 188 13 70 2.53 3.61
1fp1D02 77.80 Medicago sativaIsoliquiritigenin 2'-O-methyltransferase 3.40.50.150 235 9 70 2.99 4.23
1g8aA02 77.74 Pyrococcus horikoshiiFibrillarin-like rRNA/tRNA 2'-O-methyltransferaseFibrillarin-like pre-rRNA processing protein 3.40.50.150 176 14 70 3.26 4.62
1i9gA02 77.45 POSSIBLE RNA METHYLTRANSFERASETRNA (adenine-N1-)-methyltransferase [EC:2.1.1.36]Mycobacterium tuberculosis 3.40.50.150 184 13 67 2.99 4.41
1ne2B00 77.39 Putative uncharacterized protein Ta1320Putative methylaseThermoplasma acidophilum 3.40.50.150 180 8 67 3.06 4.52
1sqgA04 76.34 Ribosomal RNA small subunit methyltransferase B [EC:2.1.1.-]Ribosomal RNA small subunit methyltransferase BRRNA (cytosine-C5-)-methyltransferase activityRRNA base methylationEscherichia coli K-12 3.40.50.150 198 10 71 3.25 4.58
2fpoC00 76.23 Ribosomal RNA small subunit methyltransferase D [EC:2.1.1.52]RRNA (guanine-N2-)-methyltransferase activityRRNA base methylationProtein bindingEscherichia coli K-12 3.40.50.150 176 7 64 3.09 4.76
1jsxA00 76.04 Glucose inhibited division protein B [EC:2.1.-.-]RRNA base methylationRibosomal RNA small subunit methyltransferase GEscherichia coli K-12RRNA (guanine-N7-)-methyltransferase activity 3.40.50.150 193 8 66 3.11 4.65
1fp2A02 75.85 Medicago sativaIsoflavone-7-O-methyltransferase 8 3.40.50.150 249 8 68 3.36 4.89
1dusA00 75.85 Methanocaldococcus jannaschiiProtein MJ0882 3.40.50.150 192 12 68 2.89 4.24
2fhpA00 75.39 Methylase, putativeEnterococcus faecalis 3.40.50.150 177 10 64 3.16 4.87
[1]
Displaying entries 1 to 15 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2p7iA00
NFDFDVHPFVRAFTPFFRPGNLLELGSFKGDFTSRLQEHFNDITCVEASEEAISHAQGRLKDGITYIHSRFEDAQLPRRY
DNIVLTHVLEHIDDPVALLKRINDDWLAEGGRLFLVCPNANAVSRQIAVKGIISHNSAVTEAEFAHGHRCTYALDTLERD
ASRAGLQVTYRSGIFFKALANFQWDQILQTDILSKEYLDGCYQLGQQYPDLCASIFLLCEKG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2p7iA00
NFDFDVXHPFXVRAFTPFFRPGNLLELGSFKGDFTSRLQEHFNDITCVEASEEAISHAQGRLKDGITYIHSRFEDAQLPR
RYDNIVLTHVLEHIDDPVALLKRINDDWLAEGGRLFLVCPNANAVSRQIAVKXGIISHNSAVTEAEFAHGHRCTYALDTL
ERDASRAGLQVTYRSGIFFKALANFQWDQILQTDILSKEYLDGCYQLGQQYPDLCASIFLLCEKGINQ
BLAST against CATH

[top]
Domain History Events (72)

Domain assigned by cuff on 02 Apr 2008 11:33

same superfamily

Domain assignment manual match h by cuff on 02 Apr 2008 11:29

ample evidence for homology

Domain assignment manual match t by tronnberg on 18 Sep 2007 15:14

SSAP: 81.5 OV: 84 SEQ: 17. Very similar linkage and structure (only differ with one alfa helix). The query's function is unknown.

Homcheck review by tronnberg on 18 Sep 2007 15:14

SSAP: 81.5 OV: 84 SEQ: 17. Very similar linkage and structure (only differ with one alfa helix). The query's function is unknown.

Flow stage update by tronnberg on 18 Sep 2007 15:14

SSAP: 81.5 OV: 84 SEQ: 17. Very similar linkage and structure (only differ with one alfa helix). The query's function is unknown.

Homcheck allotment by tronnberg on 18 Sep 2007 15:11

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 18 Sep 2007 15:11

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 20:12

Domain "2p7iA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 20:11

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2p7iA00

Flow stage update by auto on 15 Sep 2007 16:22

Retrieved PRC_PFAMCATH results for job ID SID1036862233247872 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 16:20

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 2653 results for 2p7iA00

Update comment by auto on 15 Sep 2007 09:22

PRC_PFAMCATH job SID1036862233247872 is not yet finished.

Flow stage update by auto on 15 Sep 2007 08:47

The entry "2p7iA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 15 Sep 2007 08:47

The entry "2p7iA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 01:17

Retrieved SSAP results for job ID SID0598068410903368 and results inserted.

Domain scan ssap cath by auto on 15 Sep 2007 01:14

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1163 results for 2p7iA00

Update comment by auto on 09 Sep 2007 23:14

SSAP job SID0598068410903368 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:33

The entry "2p7iA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:33

The entry "2p7iA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:05

Giving up on SSAP job SID5076214899519552 because submission time of Wed Sep 5 16:29:54 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:05:17 2007).

Update comment by auto on 05 Sep 2007 19:49

SSAP job SID5076214899519552 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 16:29

The entry "2p7iA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 16:29

The entry "2p7iA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 11:33

Retrieved PRC results for job ID SID4019866391184448 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 11:32

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 77 results for 2p7iA00

Flow stage update by auto on 05 Sep 2007 04:11

The entry "2p7iA00" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 04:11

The entry "2p7iA00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 23:58

Retrieved HMM(SAM) results for job ID SID8744108068696512 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 23:57

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 52 results for 2p7iA00

Update comment by auto on 04 Sep 2007 12:34

HMM(SAM) job SID8744108068696512 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:15

The entry "2p7iA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:15

The entry "2p7iA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 04:32

Retrieved "2p7iA00" CATHEDRAL results for job ID SID2772667169378944 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 04:31

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 449 results for 2p7iA00

Cathedral cath submit by auto on 03 Sep 2007 14:18

The entry "2p7iA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:18

The entry "2p7iA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:27

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2p7iA00.scanlist" for "2p7iA00"

Write scan list by auto on 03 Sep 2007 12:27

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2p7iA00.scanlist" for domain "2p7iA00"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:22

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:15

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:28

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:12

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:15

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:16

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:41

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:16

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:32

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:07

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:17

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:12

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:32

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:37

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:16

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:43

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:05

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:23

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:29

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 18:34

Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 14:50

Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 10:15

Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 08:13

Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 28 Aug 2007 06:28

No satisfactory AssignClose result found.

Flow stage update by auto on 28 Aug 2007 06:12

No in_process hits for Domain "2p7iA00" ready to be processed

Flow stage update by auto on 28 Aug 2007 06:12

NW result present for Domain "2p7iA00"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2p7iA00"

Flow stage update by auto on 16 Aug 2007 17:14

Beginning processing for Domain "2p7iA00"

Insertion by auto on 16 Aug 2007 15:25

Final ChopClose added based on similarity with "2p7hB"