CATH Domain: 2p67A01 XML data for domain: 2p67A01

Molscript image for 2p67A01
2p67A01
PDB coordinates for domain 2p67A01

PDB 2p67, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.5 Single alpha-helices involved in coiled-coils or other helix-helix interfaces
1.20.5.170 Gene3D
1.20.5.170.1
1.20.5.170.1.1
1.20.5.170.1.1.1
1.20.5.170.1.1.1.1
1.20.5.170.1.1.1.1.1

[top]
Segment boundaries for domain 2p67A01

Chopping figure for domain 2p67A01
DomainStart PDB ResidueStop PDB Residue
2p67A01 0 51
2p67A02 52 262
2p67A03 263 327

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 1.20.5.170.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2wwwC01 93.17 Methylmalonic aciduria type A protein, mitochondrialHomo sapiensLAO/AO transport system kinase [EC:2.7.-.-] 1.20.5.170 52 37 90 0.96 1.06
1j2jB00 83.45 ADP-ribosylation factor-binding protein GGA1Homo sapiensProtein bindingIntracellular protein transport 1.20.5.170 41 12 72 2.62 3.61
1jm0A00 79.67 1.20.5.420 48 12 78 3.69 4.70
1vf5C03 68.97 Mastigocladus laminosusApocytochrome f 1.20.5.700 32 6 37 1.28 3.44
1m7lA00 68.61 Negative regulation of T cell proliferationProtein bindingInnate immune responseLung alveolus developmentEndocytic vesicle 1.20.5.360 40 7 37 1.37 3.68
2oarA02 67.92 Large conductance mechanosensitive channel, MscL familyLarge-conductance mechanosensitive channelMycobacterium tuberculosis H37Ra 1.20.5.220 17 11 33 0.88 2.64
3e7kA00 66.48 Rattus norvegicusCalcium channel activityCalcium ion transportIntegral to membraneProtein binding 1.20.5.1010 54 1 35 1.63 4.63
1d66B02 66.46 Regulatory protein GAL4NucleusSequence-specific DNA binding transcription factor activityTranscription activator activityPositive regulation of transcription by galactose 1.20.5.640 15 6 29 0.57 1.94
1h8bB00 64.91 TitinOryctolagus cuniculus 1.20.5.510 23 8 33 1.47 4.41
1mkmA02 57.50 Thermotoga maritimaTranscriptional regulator, IclR family 1.20.5.640 14 0 27 1.23 4.48
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2p67A01
SLINEATLAESIRRLRQGERATLAQAMTLVESRHPRHQALSTQLLDAIMPYC
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2p67A01
MSLINEATLAESIRRLRQGERATLAQAMTLVESRHPRHQALSTQLLDAIMPYC
BLAST against CATH

[top]
Domain History Events (71)

Domain assigned by cuff on 25 Feb 2009 12:33

same superfamily

Domain assignment manual match h by cuff on 25 Feb 2009 12:32

homology match

Domain assignment manual match t by tronnberg on 18 Sep 2007 14:54

SSAP: 76.9 OV: 80 SEQ: 6. Similar structure and reasonable similar linkage. Functionally different. None of the matches on the scan list with a SSAP score of at least 70 and been assaigned a CATH code has the same function as the match.

Homcheck review by tronnberg on 18 Sep 2007 14:54

SSAP: 76.9 OV: 80 SEQ: 6. Similar structure and reasonable similar linkage. Functionally different. None of the matches on the scan list with a SSAP score of at least 70 and been assaigned a CATH code has the same function as the match.

Flow stage update by tronnberg on 18 Sep 2007 14:54

SSAP: 76.9 OV: 80 SEQ: 6. Similar structure and reasonable similar linkage. Functionally different. None of the matches on the scan list with a SSAP score of at least 70 and been assaigned a CATH code has the same function as the match.

Homcheck allotment by tronnberg on 18 Sep 2007 14:42

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 18 Sep 2007 14:42

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 20:08

Domain "2p67A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 20:07

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2p67A01

Flow stage update by auto on 15 Sep 2007 16:15

Retrieved PRC_PFAMCATH results for job ID SID1679585140303752 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 16:14

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 130 results for 2p67A01

Update comment by auto on 15 Sep 2007 09:21

PRC_PFAMCATH job SID1679585140303752 is not yet finished.

Prc pfamcath submit by auto on 15 Sep 2007 08:46

The entry "2p67A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 08:46

The entry "2p67A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 01:04

Retrieved SSAP results for job ID SID2416113173806352 and results inserted.

Domain scan ssap cath by auto on 15 Sep 2007 01:01

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2240 results for 2p67A01

Update comment by auto on 09 Sep 2007 23:14

SSAP job SID2416113173806352 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:32

The entry "2p67A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:32

The entry "2p67A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:04

Giving up on SSAP job SID7681548200164512 because submission time of Wed Sep 5 16:29:15 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:04:51 2007).

Update comment by auto on 05 Sep 2007 19:49

SSAP job SID7681548200164512 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 16:29

The entry "2p67A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 16:29

The entry "2p67A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 11:30

Retrieved PRC results for job ID SID9929473116048416 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 11:29

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2p67A01

Prc cath submit by auto on 04 Sep 2007 13:50

The entry "2p67A01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 13:50

The entry "2p67A01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 12:34

Retrieved HMM(SAM) results for job ID SID7987716931169024 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 12:33

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2p67A01

Flow stage update by auto on 04 Sep 2007 10:15

The entry "2p67A01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Sep 2007 10:15

The entry "2p67A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 04:28

Retrieved "2p67A01" CATHEDRAL results for job ID SID9822299939939136 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 04:27

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 43 results for 2p67A01

Flow stage update by auto on 03 Sep 2007 14:18

The entry "2p67A01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Sep 2007 14:18

The entry "2p67A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:27

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2p67A01.scanlist" for "2p67A01"

Write scan list by auto on 03 Sep 2007 12:26

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2p67A01.scanlist" for domain "2p67A01"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:22

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:15

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:28

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:12

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:15

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:16

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:41

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:16

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:32

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:07

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:17

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:12

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:32

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:37

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:16

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:43

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:05

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:23

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:29

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 18:34

Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 14:50

Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 10:15

Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 08:12

Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 28 Aug 2007 06:27

No satisfactory AssignClose result found.

Flow stage update by auto on 28 Aug 2007 06:12

No in_process hits for Domain "2p67A01" ready to be processed

Flow stage update by auto on 28 Aug 2007 06:12

NW result present for Domain "2p67A01"

Flow stage update by auto on 21 Aug 2007 10:06

All required files are present for Domain "2p67A01"

Flow stage update by auto on 20 Aug 2007 17:33

Beginning processing for Domain "2p67A01"

Insertion by cuff on 20 Aug 2007 10:47

nice chopping