CATH Domain: 2p5yA02 XML data for domain: 2p5yA02

Molscript image for 2p5yA02
2p5yA02
PDB coordinates for domain 2p5yA02

PDB 2p5y, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.25 UDP-galactose 4-epimerase; domain 1
3.90.25.10 UDP-galactose 4-epimerase, domain 1 Gene3D
3.90.25.10.4
3.90.25.10.4.1
3.90.25.10.4.1.1
3.90.25.10.4.1.1.1
3.90.25.10.4.1.1.1.1

[top]
Segment boundaries for domain 2p5yA02

Chopping figure for domain 2p5yA02
DomainStart PDB ResidueStop PDB Residue
2p5yA01 1 174
2p5yA01 216 241
2p5yA02 175 215
2p5yA02 242 311

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 3.90.25.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ek6A01 85.84 Galactose metabolismAmino sugar and nucleotide sugar metabolismUDP-glucose 4-epimeraseProtein homodimerization activityUDP-glucose 4-epimerase activity 3.90.25.10 126 15 88 3.15 3.58
1eq2D02 84.34 Metabolic pathwaysLipopolysaccharide biosynthesisMembraneProtein bindingADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20] 3.90.25.10 101 16 79 2.32 2.93
1n7hB01 83.49 Amino sugar and nucleotide sugar metabolismGDPmannose 4,6-dehydratase [EC:4.2.1.47]Fructose and mannose metabolismCytosolMetabolic pathways 3.90.25.10 101 16 72 2.09 2.90
1e6uA02 83.28 Amino sugar and nucleotide sugar metabolismFructose and mannose metabolismMetabolic pathwaysGDP-L-fucose synthaseGDP-L-fucose synthase [EC:1.1.1.271] 3.90.25.10 94 18 79 2.99 3.77
1z7bA02 82.24 Amino sugar and nucleotide sugar metabolismOxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptorHydroxymethyl-, formyl- and related transferase activityUDP-GlcUA decarboxylase/UDP-L-Ara4N formyltransferase [EC:1.1.1.- 2.1.2.-]Bifunctional polymyxin resistance protein ArnA 3.90.25.10 89 14 68 2.18 3.18
1t2aA02 82.16 Amino sugar and nucleotide sugar metabolismGDPmannose 4,6-dehydratase [EC:4.2.1.47]GDP-mannose 4,6 dehydrataseFructose and mannose metabolismMetabolic pathways 3.90.25.10 106 16 69 2.41 3.47
1bxkA02 80.70 Streptomycin biosynthesisPolyketide sugar unit biosynthesisMetabolic pathwaysDTDP-glucose 4,6-dehydrataseDTDP-glucose 4,6-dehydratase [EC:4.2.1.46] 3.90.25.10 89 10 55 1.67 2.99
1i24A02 80.04 Amino sugar and nucleotide sugar metabolismZinc ion bindingGlycolipid biosynthetic processChloroplastSulfotransferase activity 3.90.25.10 141 17 75 3.05 4.06
1oc2A02 79.64 Streptomycin biosynthesisPolyketide sugar unit biosynthesisMetabolic pathwaysDTDP-glucose 4,6-dehydrataseStreptococcus suis 3.90.25.10 77 16 55 2.48 4.44
1rkxB02 77.95 Amino sugar and nucleotide sugar metabolismCDP-glucose 4,6-dehydratase [EC:4.2.1.45]CDP-D-glucose-4,6-dehydrataseYersinia pseudotuberculosis 3.90.25.10 154 11 61 2.70 4.42
2hrzA02 74.79 Agrobacterium tumefaciens str. C58Nucleoside-diphosphate-sugar epimerase 3.90.25.10 98 17 75 3.77 4.98
[1]
Displaying entries 1 to 11 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2p5yA02
GPRQDPHGEAGVVAIFAERVLKGLPVTLYARKTPGDEGCVRTGEGHTTREVLMAVAEAAGKAPEVQPAPPRPGDLERSVL
SPLKLMAHGWRPKVGFQEGIRLTVDHFRGAV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2p5yA02
GPRQDPHGEAGVVAIFAERVLKGLPVTLYARKTPGDEGCVRTGEGHTTREVLMAVAEAAGKAPEVQPAPPRPGDLERSVL
SPLKLMAHGWRPKVGFQEGIRLTVDHFRGAV
BLAST against CATH

[top]
Domain History Events (13)

Domain assigned by auto on 02 Apr 2008 17:24

Assigning to "3.90.25.10" based on similarity with "2p5uA02"

Flow stage update by auto on 02 Apr 2008 17:23

No in_process hits for Domain "2p5yA02" ready to be processed

Update comment by auto on 02 Apr 2008 17:21

Domain "2p5yA02" hits Domain "2p5uB02" (100% over 100%) which is currently in process

Update comment by auto on 02 Apr 2008 17:14

Domain "2p5yA02" hits Domain "2p5uC02" (100% over 100%) which is currently in process

Update comment by auto on 02 Apr 2008 17:05

Domain "2p5yA02" hits Domain "2p5uA02" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2p5yA02" hits Domain "2p5uD02" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2p5yA02" hits Domain "2p5uD02" (100% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:52

Domain "2p5yA02" hits Domain "2p5uD02" (100% over 100%) which is currently in process

Flow stage update by auto on 04 Aug 2007 06:37

Domain "2p5yA02" hits Domain "2p5uD02" (100% over 100%) which is currently in process

Flow stage update by auto on 04 Aug 2007 06:37

NW result present for Domain "2p5yA02"

Flow stage update by auto on 16 Jul 2007 22:39

All required files are present for Domain "2p5yA02"

Flow stage update by auto on 15 Jul 2007 03:11

Beginning processing for Domain "2p5yA02"

Insertion by auto on 15 Jul 2007 02:39

Final ChopClose added based on similarity with "2c20A"