Domain assigned by cuff on 02 Apr 2008 11:46
same superfamily
CATH Domain: 2p4oA01
2p4oA01
PDB 2p4o, Chain A, Domain 1
| CATH Code | Level Description | Links |
|---|---|---|
 2
| Mainly Beta | |
 2.120
| 6 Propellor | |
 2.120.10
| Neuraminidase | |
 2.120.10.30
| TolB, C-terminal domain | Gene3D |
 2.120.10.30.6
| ||
 2.120.10.30.6.1
| ||
 2.120.10.30.6.1.1
| ||
 2.120.10.30.6.1.1.1
| ||
 2.120.10.30.6.1.1.1.1
|
Structural Neighbourhood (5 entries)
There are 5 matching structural neighberhood comparisons for CATH ID 2.120.10.30.6.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 5 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
|
1npeA00 | 79.38 | 2.120.10.30 | 263 | 13 | 80 | 2.95 | 3.69 | |
|
1rwiA00 | 79.37 | 2.120.10.30 | 256 | 16 | 85 | 3.40 | 3.97 | |
|
1v04A00 | 77.22 | 2.120.10.30 | 332 | 12 | 74 | 3.07 | 4.13 | |
|
1nr0A01 | 76.71 | 2.130.10.10 | 298 | 13 | 78 | 3.77 | 4.82 | |
|
1cruA00 | 73.52 | 2.120.10.30 | 448 | 12 | 55 | 2.66 | 4.77 |
[1]
Displaying entries 1 to 5 (page 1 of 1)
Domain ATOM Sequence
>pdb|2p4oA01 KPIELAPAKIITSFPVNTFLENLASAPDGTIFVTNHEVGEIVSITPDGNQQIHATVEGKVSGLAFTSNGDLVATGWNADS IPVVSLVKSDGTVETLLTLPDAIFLNGITPLSDTQYLTADSYRGAIWLIDVVQPSGSIWLEHPLARSNSESVFPAANGLK RFGNFLYVSNTEKLLLRIPVDSTDKPGEPEIFVEQTNIDDFAFDVEGNLYGATHIYNSVVRIAPDRSTTIIAQAEQGVIG STAVAFGQTEGDCTAIYVVTNGGFLPPPTGVVPANVVRLEVGKPGYPLG
Domain COMBS Sequence
>pdb|2p4oA01 KPIELAPAKIITSFPVNTFLENLASAPDGTIFVTNHEVGEIVSITPDGNQQIHATVEGKVSGLAFTSNGDLVATGWNADS IPVVSLVKSDGTVETLLTLPDAIFLNGITPLSDTQYLTADSYRGAIWLIDVVQPSGSIWLEHPXLARSNSESVFPAANGL KRFGNFLYVSNTEKXLLLRIPVDSTDKPGEPEIFVEQTNIDDFAFDVEGNLYGATHIYNSVVRIAPDRSTTIIAQAEQGV IGSTAVAFGQTEGDCTAIYVVTNGGXFLPPPTGVVPANVVRLEVGKPGYPLG
Domain History Events (71)
Domain assignment manual match h by cuff on 02 Apr 2008 11:42
nice scores
Domain assignment manual match t by tronnberg on 18 Sep 2007 12:36
SSAP: 82.0 OV: 80 SEQ: 15. Similar structure and linkage. The query's function is unknown.
Homcheck review by tronnberg on 18 Sep 2007 12:36
SSAP: 82.0 OV: 80 SEQ: 15. Similar structure and linkage. The query's function is unknown.
Flow stage update by tronnberg on 18 Sep 2007 12:36
SSAP: 82.0 OV: 80 SEQ: 15. Similar structure and linkage. The query's function is unknown.
Homcheck allotment by tronnberg on 18 Sep 2007 12:34
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 18 Sep 2007 12:34
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 15 Sep 2007 19:58
Domain "2p4oA01" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 15 Sep 2007 19:57
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2p4oA01
Flow stage update by auto on 15 Sep 2007 16:05
Retrieved PRC_PFAMCATH results for job ID SID3226911919408704 and results inserted.
Domain scan prc pfamcath by auto on 15 Sep 2007 16:04
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 229 results for 2p4oA01
Update comment by auto on 15 Sep 2007 09:20
PRC_PFAMCATH job SID3226911919408704 is not yet finished.
Flow stage update by auto on 15 Sep 2007 08:45
The entry "2p4oA01" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 15 Sep 2007 08:45
The entry "2p4oA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 15 Sep 2007 00:33
Retrieved SSAP results for job ID SID1300515130344960 and results inserted.
Domain scan ssap cath by auto on 15 Sep 2007 00:32
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 78 results for 2p4oA01
Update comment by auto on 09 Sep 2007 23:13
SSAP job SID1300515130344960 is not yet finished.
Ssap cath submit by auto on 09 Sep 2007 22:31
The entry "2p4oA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 22:31
The entry "2p4oA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 20:03
Giving up on SSAP job SID4378457715812096 because submission time of Wed Sep 5 16:28:02 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:03:56 2007).
Update comment by auto on 05 Sep 2007 19:48
SSAP job SID4378457715812096 is not yet finished.
Flow stage update by auto on 05 Sep 2007 16:28
The entry "2p4oA01" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 05 Sep 2007 16:28
The entry "2p4oA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 11:19
Retrieved PRC results for job ID SID4578888267361120 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 11:18
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 41 results for 2p4oA01
Flow stage update by auto on 04 Sep 2007 13:49
The entry "2p4oA01" has been submitted to the PRC webservice.
Prc cath submit by auto on 04 Sep 2007 13:49
The entry "2p4oA01" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 12:24
Retrieved HMM(SAM) results for job ID SID5049109999333760 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 12:23
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 15 results for 2p4oA01
Sam cath submit by auto on 04 Sep 2007 10:14
The entry "2p4oA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 10:14
The entry "2p4oA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 04:17
Retrieved "2p4oA01" CATHEDRAL results for job ID SID6172151450427328 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 04:16
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 49 results for 2p4oA01
Cathedral cath submit by auto on 03 Sep 2007 14:17
The entry "2p4oA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 14:17
The entry "2p4oA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 12:24
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2p4oA01.scanlist" for "2p4oA01"
Write scan list by auto on 03 Sep 2007 12:24
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2p4oA01.scanlist" for domain "2p4oA01"
Update comment by auto on 03 Sep 2007 10:11
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:31
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:36
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:32
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:22
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:22
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:15
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:28
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:12
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:15
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:16
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:41
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:16
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:32
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:07
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 16:17
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 10:12
Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 06:32
Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 02:37
Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 22:16
Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 14:42
Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 09:05
Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 02:23
Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 22:29
Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 18:34
Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 14:50
Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 10:15
Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 08:12
Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 28 Aug 2007 06:27
No satisfactory AssignClose result found.
Flow stage update by auto on 28 Aug 2007 06:12
No in_process hits for Domain "2p4oA01" ready to be processed
Flow stage update by auto on 28 Aug 2007 06:12
NW result present for Domain "2p4oA01"
Flow stage update by auto on 21 Aug 2007 10:06
All required files are present for Domain "2p4oA01"
Flow stage update by auto on 20 Aug 2007 17:33
Beginning processing for Domain "2p4oA01"
Insertion by cuff on 20 Aug 2007 14:17
nice chopping
