Domain assigned by cuff on 04 Apr 2008 15:07
same superfamily
CATH Domain: 2p4gA00
2p4gA00
PDB 2p4g, Chain A, Domain 0
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2p4gA00 VTTEQIVYGALPLTTINEPECRAIAITSINGSATLSGVSGPGDQTDADLLIQLRGWADAIVVGAETARKENYGPVVLPHG IKNQRQKLGRCGLPKLTLLSKSLYFDFSSELFSPDLPSELSPLVITQQPANNSEQWDQRLQKLIDVGVEVIVAPTSTNPL KIAFDALHARRLKKISIEGGPSVYRQALSLGIVDRLHLTIAPNIICPVESPLFGKISDDSFTTRLVLELSSSPNGLIFSR YKVIRD
Domain COMBS Sequence
>pdb|2p4gA00 GXLTDXQRDSASSSTVTTEQIVYGALPLTTINEPECRAIAITSINGSATLSGVSGPXGDQTDADLLIQLRGWADAIVVGA ETARKENYGPVVLPHGIKNQRQKLGRCGLPKLTLLSKSLYFDFSSELFSPDLPSELSPLVITQQPANNSEQWDQRLQKLI DVGVEVIVAPTSTNPLKIAFDALHARRLKKISIEGGPSVYRQALSLGIVDRLHLTIAPNIICPVESPLFGKISDDSFTTR LVLEXLSSSPNGLIFSRYKVIRDTLGNPTQ
Domain History Events (58)
Domain assignment manual match h by cuff on 04 Apr 2008 15:06
same family in scop, same function, great scores
Domain assignment manual match t by tronnberg on 18 Sep 2007 12:33
SSAP: 78.0 OV: 67 SEQ: 18. Similar linkage and reasonable similar structure (differ with one alfa helix). The query's function is unknown.
Homcheck review by tronnberg on 18 Sep 2007 12:33
SSAP: 78.0 OV: 67 SEQ: 18. Similar linkage and reasonable similar structure (differ with one alfa helix). The query's function is unknown.
Flow stage update by tronnberg on 18 Sep 2007 12:33
SSAP: 78.0 OV: 67 SEQ: 18. Similar linkage and reasonable similar structure (differ with one alfa helix). The query's function is unknown.
Homcheck allotment by tronnberg on 18 Sep 2007 12:30
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 18 Sep 2007 12:30
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 15 Sep 2007 19:57
Domain "2p4gA00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 15 Sep 2007 19:56
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2p4gA00
Flow stage update by auto on 15 Sep 2007 16:04
Retrieved PRC_PFAMCATH results for job ID SID4386203966717024 and results inserted.
Domain scan prc pfamcath by auto on 15 Sep 2007 16:03
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 23 results for 2p4gA00
Update comment by auto on 15 Sep 2007 09:20
PRC_PFAMCATH job SID4386203966717024 is not yet finished.
Prc pfamcath submit by auto on 15 Sep 2007 08:45
The entry "2p4gA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 15 Sep 2007 08:45
The entry "2p4gA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 15 Sep 2007 00:32
Retrieved SSAP results for job ID SID5124776031550896 and results inserted.
Domain scan ssap cath by auto on 15 Sep 2007 00:30
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 528 results for 2p4gA00
Update comment by auto on 09 Sep 2007 23:13
SSAP job SID5124776031550896 is not yet finished.
Ssap cath submit by auto on 09 Sep 2007 22:31
The entry "2p4gA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 22:31
The entry "2p4gA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 20:03
Giving up on SSAP job SID8363107587389568 because submission time of Wed Sep 5 16:27:54 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:03:49 2007).
Update comment by auto on 05 Sep 2007 19:48
SSAP job SID8363107587389568 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 16:27
The entry "2p4gA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 16:27
The entry "2p4gA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 11:18
Retrieved PRC results for job ID SID7486628283491024 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 11:17
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 12 results for 2p4gA00
Prc cath submit by auto on 04 Sep 2007 13:49
The entry "2p4gA00" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 13:49
The entry "2p4gA00" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 12:23
Retrieved HMM(SAM) results for job ID SID0426537273038400 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 12:22
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 10 results for 2p4gA00
Sam cath submit by auto on 04 Sep 2007 10:13
The entry "2p4gA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 10:13
The entry "2p4gA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 04:16
Retrieved "2p4gA00" CATHEDRAL results for job ID SID0154235289702976 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 04:14
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 467 results for 2p4gA00
Flow stage update by auto on 03 Sep 2007 14:17
The entry "2p4gA00" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 03 Sep 2007 14:17
The entry "2p4gA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 12:24
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2p4gA00.scanlist" for "2p4gA00"
Write scan list by auto on 03 Sep 2007 12:24
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2p4gA00.scanlist" for domain "2p4gA00"
Update comment by auto on 03 Sep 2007 10:11
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:31
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:36
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:32
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:22
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:22
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:15
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:28
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:12
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:15
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:16
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:41
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:16
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:32
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:07
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Flow stage update by auto on 31 Aug 2007 20:02
No satisfactory AssignClose result found.
Flow stage update by auto on 31 Aug 2007 19:48
No in_process hits for Domain "2p4gA00" ready to be processed
Flow stage update by auto on 31 Aug 2007 19:48
NW result present for Domain "2p4gA00"
Flow stage update by auto on 24 Aug 2007 10:06
All required files are present for Domain "2p4gA00"
Flow stage update by auto on 23 Aug 2007 18:40
Beginning processing for Domain "2p4gA00"
Insertion by cuff on 23 Aug 2007 12:19
nice chopping
