Domain assigned by auto on 15 Aug 2007 01:08
Assigning to "2.80.10.50" based on similarity with "2p23A00"
There are 17 matching structural neighberhood comparisons for CATH ID 2.80.10.50.3.1.1.1.1 (SIMAX score < 5)
>pdb|2p39A00 SPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYF DPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFN
Assigning to "2.80.10.50" based on similarity with "2p23A00"
No in_process hits for Domain "2p39A00" ready to be processed
Domain "2p39A00" hits Domain "2p23A00" (35.2941176470588% over 86.4516129032258%) which is currently in process
Domain "2p39A00" hits Domain "2p23B00" (35.2941176470588% over 86.4516129032258%) which is currently in process
NW result present for Domain "2p39A00"
All required files are present for Domain "2p39A00"
Beginning processing for Domain "2p39A00"
Final ChopClose added based on similarity with "2p23A"