CATH Domain: 2p2sA02 XML data for domain: 2p2sA02

Molscript image for 2p2sA02
2p2sA02
PDB coordinates for domain 2p2sA02

PDB 2p2s, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.360 Dihydrodipicolinate Reductase; domain 2
3.30.360.10 Dihydrodipicolinate Reductase; domain 2 Gene3D
3.30.360.10.4
3.30.360.10.4.1
3.30.360.10.4.1.1
3.30.360.10.4.1.1.1
3.30.360.10.4.1.1.1.1

[top]
Segment boundaries for domain 2p2sA02

Chopping figure for domain 2p2sA02
DomainStart PDB ResidueStop PDB Residue
2p2sA01 2 122
2p2sA01 294 310
2p2sA02 123 293
2p2sA02 311 335

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.360.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1h6dA02 83.27 Glucose-fructose oxidoreductase [EC:1.1.99.28]Zymomonas mobilisGlucose--fructose oxidoreductase 3.30.360.10 190 13 86 3.17 3.67
1tltA02 80.62 Virulence factorVirulence factor mviM homologEscherichia coli K-12 3.30.360.10 186 8 83 3.44 4.10
1xeaA02 78.17 Vibrio choleraeOxidoreductase, Gfo/Idh/MocA familyVirulence factor 3.30.360.10 187 5 80 3.95 4.92
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2p2sA02
FNERINVDSALFAGELVQRGEIGRVIQTGVGPHRERGARPDWFYQKRQYGGILCDIGIHQIEQFLYFTGNTNARVVTSQT
ANYHHPHHPEFEDFGDALLGDNGATGYFRCDWFTPDGLSVWGDGRLTILGTEGYIEIRKYVDLTRGESNVVYLVNGKGEQ
RFTPAGSVEASQSHIFKATELSILAQQAANKIA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2p2sA02
FNERINVDSALFAGELVQRGEIGRVIQTXGVGPHRERGARPDWFYQKRQYGGILCDIGIHQIEQFLYFTGNTNARVVTSQ
TANYHHPHHPEFEDFGDAXLLGDNGATGYFRCDWFTPDGLSVWGDGRLTILGTEGYIEIRKYVDLTRGESNVVYLVNGKG
EQRFTPAGSVEAXSQSHIFKATELSILAQQAANKIA
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 09 Apr 2008 17:12

Assigning to "3.30.360.10" based on similarity with "2p2sB02"

Flow stage update by auto on 09 Apr 2008 17:05

No in_process hits for Domain "2p2sA02" ready to be processed

Update comment by auto on 03 Sep 2007 20:10

Domain "2p2sA02" hits Domain "2p2sB02" (98.469387755102% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2p2sA02" hits Domain "2p2sB02" (98.469387755102% over 100%) which is currently in process

Update comment by auto on 31 Aug 2007 19:49

Domain "2p2sA02" hits Domain "2p2sB02" (98.469387755102% over 100%) which is currently in process

Flow stage update by auto on 31 Aug 2007 19:48

Domain "2p2sA02" hits Domain "2p2sB02" (98.469387755102% over 100%) which is currently in process

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2p2sA02"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2p2sA02"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2p2sA02"

Insertion by auto on 23 Aug 2007 14:11

Final ChopClose added based on similarity with "2p2sB"