CATH Domain: 2p1zB00 XML data for domain: 2p1zB00

Molscript image for 2p1zB00
2p1zB00
PDB coordinates for domain 2p1zB00

PDB 2p1z, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.2020 Gene3D
3.40.50.2020.19
3.40.50.2020.19.1
3.40.50.2020.19.1.1
3.40.50.2020.19.1.1.1
3.40.50.2020.19.1.1.1.1

[top]
Segment boundaries for domain 2p1zB00

Chopping figure for domain 2p1zB00
DomainStart PDB ResidueStop PDB Residue
2p1zB00 2 176

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.50.2020.19.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1u9yA02 79.47 Methanocaldococcus jannaschiiRibose-phosphate pyrophosphokinase 3.40.50.2020 124 20 71 3.38 4.73
1ecfA02 77.08 Purine metabolismMetabolic pathwaysAlanine, aspartate and glutamate metabolismAmidophosphoribosyltransferase [EC:2.4.2.14]Purine nucleotide biosynthetic process 3.40.50.2020 137 17 73 3.34 4.52
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2p1zB00
SKKAELAELVKELAVVHGKKEADYYVDLRRATLHARASRLIGELLRELTADWDYVAVGGLTLGADPVATSVHADGREIHA
FVVRKEAKGQRRIEGPDVVGKKVLVVEDTTTTGNSPLTAVKALREAGAEVVGVATVVDRATGAADVIAAEGLEYRYILGL
EDLGL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2p1zB00
SNAXSKKAELAELVKELAVVHGKVTLSSGKEADYYVDLRRATLHARASRLIGELLRELTADWDYVAVGGLTLGADPVATS
VXHADGREIHAFVVRKEAKKHGXQRRIEGPDVVGKKVLVVEDTTTTGNSPLTAVKALREAGAEVVGVATVVDRATGAADV
IAAEGLEYRYILGLEDLGLA
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 02 Apr 2008 12:01

Assigning to "3.40.50.2020" based on similarity with "2p1zA00"

Flow stage update by auto on 02 Apr 2008 11:59

No in_process hits for Domain "2p1zB00" ready to be processed

Update comment by auto on 03 Sep 2007 20:10

Domain "2p1zB00" hits Domain "2p1zA00" (98.3333333333333% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2p1zB00" hits Domain "2p1zA00" (98.3333333333333% over 100%) which is currently in process

Update comment by auto on 31 Aug 2007 19:49

Domain "2p1zB00" hits Domain "2p1zA00" (98.3333333333333% over 100%) which is currently in process

Flow stage update by auto on 31 Aug 2007 19:48

Domain "2p1zB00" hits Domain "2p1zA00" (98.3333333333333% over 100%) which is currently in process

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2p1zB00"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2p1zB00"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2p1zB00"

Insertion by auto on 23 Aug 2007 14:11

Final ChopClose added based on similarity with "2p1zA"