CATH Domain: 2p1jA01 XML data for domain: 2p1jA01

Molscript image for 2p1jA01
2p1jA01
PDB coordinates for domain 2p1jA01

PDB 2p1j, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.10 Gene3D
3.30.420.10.17
3.30.420.10.17.1
3.30.420.10.17.1.1
3.30.420.10.17.1.1.1
3.30.420.10.17.1.1.1.1

[top]
Segment boundaries for domain 2p1jA01

Chopping figure for domain 2p1jA01
DomainStart PDB ResidueStop PDB Residue
2p1jA01 357 494
2p1jA02 495 520

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2p1jA01
TFVVLDFETTGLDPQVDEIIEIGAVKIQGGQIVDEYHTLIKPSREISRKSSEITGITQEMLENKRSIEEVLPEFLGFLED
SIIVAHNANFDYRFLRLWIKKVMGLDWERPYIDTLALAKSLLKLRSYSLDSVVEKLGL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2p1jA01
MSLSDDSTFGDATFVVLDFETTGLDPQVDEIIEIGAVKIQGGQIVDEYHTLIKPSREISRKSSEITGITQEMLENKRSIE
EVLPEFLGFLEDSIIVAHNANFDYRFLRLWIKKVMGLDWERPYIDTLALAKSLLKLRSYSLDSVVEKLGL
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 02 Apr 2008 12:04

Assigning to "3.30.420.10" based on similarity with "2p1jB01"

Flow stage update by auto on 02 Apr 2008 12:03

No in_process hits for Domain "2p1jA01" ready to be processed

Update comment by auto on 06 Sep 2007 22:06

Domain "2p1jA01" hits Domain "2p1jB01" (100% over 100%) which is currently in process

Flow stage update by auto on 06 Sep 2007 22:05

Domain "2p1jA01" hits Domain "2p1jB01" (100% over 100%) which is currently in process

Flow stage update by auto on 06 Sep 2007 22:05

NW result present for Domain "2p1jA01"

Flow stage update by auto on 04 Sep 2007 14:04

All required files are present for Domain "2p1jA01"

Flow stage update by auto on 03 Sep 2007 20:09

Beginning processing for Domain "2p1jA01"

Insertion by cuff on 03 Sep 2007 14:12

nice chopping