Domain assigned by cuff on 09 Apr 2008 16:33
same superfamily
CATH Domain: 2p19A01
2p19A01
PDB 2p19, Chain A, Domain 1
Structural Neighbourhood (2 entries)
There are 2 matching structural neighberhood comparisons for CATH ID 3.40.1410.10.10.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 2 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
3ddvB01 | 88.57 | 3.40.1410.10 | 137 | 24 | 92 | 1.72 | 1.86 | |
|
2oggA01 | 86.03 | 3.40.1410.10 | 133 | 17 | 95 | 2.35 | 2.46 |
[1]
Displaying entries 1 to 2 (page 1 of 1)
Domain ATOM Sequence
>pdb|2p19A01 DPKTRVLEHRLLAASSAIAEKLGVSAGDEVLLIRRLRSTGDIPVAILENYLPPAFNDVSLDELEKGGLYDALRSRGVVLK IANQKIGARRAVGEESTLLDIEDGGPLLTVERVALDNSGQVIELGSHCYR
Domain History Events (72)
Domain assignment manual match h by cuff on 09 Apr 2008 16:32
nice scores, same superfamily in scop
Domain assignment manual match t by tronnberg on 18 Sep 2007 10:04
SSAP: 77.0 OV: 65 SEQ: 10. Similar linkage and structure (differ with a three alfa helices at one of the termini). Functionally different. None of the matches on the scan list (with a assigned CATH code and a SSAP score of 70 or above) has the same function as the query.
Homcheck review by tronnberg on 18 Sep 2007 10:04
SSAP: 77.0 OV: 65 SEQ: 10. Similar linkage and structure (differ with a three alfa helices at one of the termini). Functionally different. None of the matches on the scan list (with a assigned CATH code and a SSAP score of 70 or above) has the same function as the query.
Flow stage update by tronnberg on 18 Sep 2007 10:04
SSAP: 77.0 OV: 65 SEQ: 10. Similar linkage and structure (differ with a three alfa helices at one of the termini). Functionally different. None of the matches on the scan list (with a assigned CATH code and a SSAP score of 70 or above) has the same function as the query.
Homcheck allotment by tronnberg on 18 Sep 2007 09:59
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 18 Sep 2007 09:59
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 15 Sep 2007 19:35
Domain "2p19A01" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 15 Sep 2007 19:34
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2p19A01
Flow stage update by auto on 15 Sep 2007 15:41
Retrieved PRC_PFAMCATH results for job ID SID9351226988157504 and results inserted.
Domain scan prc pfamcath by auto on 15 Sep 2007 15:40
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 13 results for 2p19A01
Update comment by auto on 15 Sep 2007 09:18
PRC_PFAMCATH job SID9351226988157504 is not yet finished.
Prc pfamcath submit by auto on 15 Sep 2007 08:42
The entry "2p19A01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 15 Sep 2007 08:42
The entry "2p19A01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 14 Sep 2007 23:45
Retrieved SSAP results for job ID SID7796495218490672 and results inserted.
Domain scan ssap cath by auto on 14 Sep 2007 23:43
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1614 results for 2p19A01
Update comment by auto on 09 Sep 2007 23:11
SSAP job SID7796495218490672 is not yet finished.
Flow stage update by auto on 09 Sep 2007 22:29
The entry "2p19A01" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 09 Sep 2007 22:29
The entry "2p19A01" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 20:01
Giving up on SSAP job SID4903385068270208 because submission time of Wed Sep 5 16:25:09 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:01:41 2007).
Update comment by auto on 05 Sep 2007 19:45
SSAP job SID4903385068270208 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 16:25
The entry "2p19A01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 16:25
The entry "2p19A01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 10:56
Retrieved PRC results for job ID SID6252298976365120 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 10:55
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 7 results for 2p19A01
Prc cath submit by auto on 05 Sep 2007 04:00
The entry "2p19A01" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 04:00
The entry "2p19A01" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 23:37
Retrieved HMM(SAM) results for job ID SID1594563455731398 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 23:36
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 6 results for 2p19A01
Update comment by auto on 04 Sep 2007 12:18
HMM(SAM) job SID1594563455731398 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 10:11
The entry "2p19A01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 10:11
The entry "2p19A01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 03:50
Retrieved "2p19A01" CATHEDRAL results for job ID SID9581931674123584 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 03:48
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 193 results for 2p19A01
Flow stage update by auto on 03 Sep 2007 14:14
The entry "2p19A01" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 03 Sep 2007 14:14
The entry "2p19A01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 12:18
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2p19A01.scanlist" for "2p19A01"
Write scan list by auto on 03 Sep 2007 12:18
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2p19A01.scanlist" for domain "2p19A01"
Update comment by auto on 03 Sep 2007 10:11
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:31
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:36
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:32
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:22
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:22
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:15
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:28
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:12
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:15
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:16
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:41
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:15
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:32
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:06
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 16:17
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 10:12
Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 06:32
Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 02:37
Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 22:16
Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 14:42
Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 09:05
Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 02:23
Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 22:29
Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 18:33
Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 14:50
Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 10:15
Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 08:12
Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 28 Aug 2007 06:27
No satisfactory AssignClose result found.
Flow stage update by auto on 28 Aug 2007 06:12
No in_process hits for Domain "2p19A01" ready to be processed
Flow stage update by auto on 28 Aug 2007 06:12
NW result present for Domain "2p19A01"
Flow stage update by auto on 19 Aug 2007 10:12
All required files are present for Domain "2p19A01"
Flow stage update by auto on 16 Aug 2007 17:14
Beginning processing for Domain "2p19A01"
Insertion by cuff on 16 Aug 2007 14:39
nice chopping
