CATH Domain: 2p0oA02 XML data for domain: 2p0oA02

Molscript image for 2p0oA02
2p0oA02
PDB coordinates for domain 2p0oA02

PDB 2p0o, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.100 Cyclophilin
2.40.100.10 Cyclophilin Gene3D
2.40.100.10.9
2.40.100.10.9.1
2.40.100.10.9.1.1
2.40.100.10.9.1.1.1
2.40.100.10.9.1.1.1.1

[top]
Segment boundaries for domain 2p0oA02

Chopping figure for domain 2p0oA02
DomainStart PDB ResidueStop PDB Residue
2p0oA01 0 238
2p0oA02 239 369

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 2.40.100.10.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1x7fA02 90.04 Outer surface proteinBacillus cereus ATCC 14579 2.40.100.10 119 24 88 1.24 1.41
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2p0oA02
QFLLEVAPSESRYLKRILGTHTNRLDAARDVLRSELATIESEQTEARPVGTVTIDNEKYGRYGEIQVTLVDLPKDEKVNT
ITRIIDKDQTILPLIKAGNQFTLVTEGTIENEFRKLNN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2p0oA02
QFLLEVAPSESRYLKRILGTHTNRLDAARDVLRSELSRTSEXFRKDEIATIESEQTEARPVGTVTIDNEKYGRYXGEIQV
TLVDLPKDEKVNTITRIIDKDQTILPLIKAGNQFTLVTEGTIENEFRKLNN
BLAST against CATH

[top]
Domain History Events (59)

Domain assigned by cuff on 30 Apr 2008 14:51

same superfamily

Domain assignment manual match h by cuff on 30 Apr 2008 14:49

same superfamily in scop, nice structural match. the two TBA should be placed into this superfamily as well

Domain assignment manual match a by tronnberg on 17 Sep 2007 16:50

SSAP: 73.3 OV: 63 SEQ: 8. Similar linkage but there are a few structual differences especially in the size of the beta strands. The query's function is unknown. I believe that 1x7fA02 (TBA) should be assign to the same topology as the query.

Homcheck review by tronnberg on 17 Sep 2007 16:50

SSAP: 73.3 OV: 63 SEQ: 8. Similar linkage but there are a few structual differences especially in the size of the beta strands. The query's function is unknown. I believe that 1x7fA02 (TBA) should be assign to the same topology as the query.

Flow stage update by tronnberg on 17 Sep 2007 16:50

SSAP: 73.3 OV: 63 SEQ: 8. Similar linkage but there are a few structual differences especially in the size of the beta strands. The query's function is unknown. I believe that 1x7fA02 (TBA) should be assign to the same topology as the query.

Homcheck allotment by tronnberg on 17 Sep 2007 16:42

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 17 Sep 2007 16:42

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 19:21

Domain "2p0oA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 19:20

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2p0oA02

Flow stage update by auto on 15 Sep 2007 15:27

Retrieved PRC_PFAMCATH results for job ID SID4363016082959640 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 15:26

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 17 results for 2p0oA02

Update comment by auto on 15 Sep 2007 09:17

PRC_PFAMCATH job SID4363016082959640 is not yet finished.

Prc pfamcath submit by auto on 15 Sep 2007 08:40

The entry "2p0oA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 08:40

The entry "2p0oA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 14 Sep 2007 23:20

Retrieved SSAP results for job ID SID4711198562618376 and results inserted.

Domain scan ssap cath by auto on 14 Sep 2007 23:18

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 602 results for 2p0oA02

Update comment by auto on 09 Sep 2007 23:10

SSAP job SID4711198562618376 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:27

The entry "2p0oA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:27

The entry "2p0oA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:00

Giving up on SSAP job SID5887523750967424 because submission time of Wed Sep 5 16:22:26 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:00:22 2007).

Update comment by auto on 05 Sep 2007 19:44

SSAP job SID5887523750967424 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 16:22

The entry "2p0oA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 16:22

The entry "2p0oA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 10:42

Retrieved PRC results for job ID SID8779994757382944 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 10:42

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2p0oA02

Flow stage update by auto on 05 Sep 2007 03:57

The entry "2p0oA02" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 03:57

The entry "2p0oA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 23:25

Retrieved HMM(SAM) results for job ID SID0783445496335616 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 23:24

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2p0oA02

Update comment by auto on 04 Sep 2007 12:16

HMM(SAM) job SID0783445496335616 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:09

The entry "2p0oA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:09

The entry "2p0oA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 03:35

Retrieved "2p0oA02" CATHEDRAL results for job ID SID7233070861338640 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 03:34

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 42 results for 2p0oA02

Cathedral cath submit by auto on 03 Sep 2007 14:12

The entry "2p0oA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:12

The entry "2p0oA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:16

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2p0oA02.scanlist" for "2p0oA02"

Write scan list by auto on 03 Sep 2007 12:16

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2p0oA02.scanlist" for domain "2p0oA02"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:36

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:21

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:22

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:15

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:28

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:12

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:14

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:16

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:41

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:15

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:32

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:06

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 31 Aug 2007 20:01

No satisfactory AssignClose result found.

Flow stage update by auto on 31 Aug 2007 19:48

No in_process hits for Domain "2p0oA02" ready to be processed

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2p0oA02"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2p0oA02"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2p0oA02"

Insertion by cuff on 23 Aug 2007 12:19

nice chopping