Domain assigned by cuff on 09 Apr 2008 17:04
same superfamily
CATH Domain: 2p0lA00
2p0lA00
PDB 2p0l, Chain A, Domain 0
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2p0lA00 EWQDLAQLPVSIFKDYVTDAQDAEKPFIWTEVFLREINRSNQEIILHIWPTKTVILGLDRELPHLELAKKEIISRGYEPV VRNFGGLAVVADEGILNFSLVIPDVFLSISDGYLIVDFIRSIFSDFYQPIEHFEVETSYCPGKFDLSINGKKFAGLAQRR IKNGIAVSIYLSVCGDQKGRSQISDFYKIGLGDTGSPIAYPNVDPEIANLSDLLDCPTVEDVIDRLISLKQVGFNDRLLI RPDLVAEFDRFQAKSAN
Domain COMBS Sequence
>pdb|2p0lA00 XSLEWQDLAQLPVSIFKDYVTDAQDAEKPFIWTEVFLREINRSNQEIILHIWPXTKTVILGXLDRELPHLELAKKEIISR GYEPVVRNFGGLAVVADEGILNFSLVIPDVFERKLSISDGYLIXVDFIRSIFSDFYQPIEHFEVETSYCPGKFDLSINGK KFAGLAQRRIKNGIAVSIYLSVCGDQKGRSQXISDFYKIGLGDTGSPIAYPNVDPEIXANLSDLLDCPXTVEDVIDRXLI SLKQVGFNDRLLXIRPDLVAEFDRFQAKSXAN
Domain History Events (73)
Domain assignment manual match h by cuff on 09 Apr 2008 17:02
great structural match, same family in scop
Domain assignment manual match t by tronnberg on 17 Sep 2007 16:28
SSAP: 78.3 OV: 88 SEQ: 19. Similar linkage and structure. None of the macthes on the scan list with a SSAP score of 70 or above has the same function as the query.
Homcheck review by tronnberg on 17 Sep 2007 16:28
SSAP: 78.3 OV: 88 SEQ: 19. Similar linkage and structure. None of the macthes on the scan list with a SSAP score of 70 or above has the same function as the query.
Flow stage update by tronnberg on 17 Sep 2007 16:28
SSAP: 78.3 OV: 88 SEQ: 19. Similar linkage and structure. None of the macthes on the scan list with a SSAP score of 70 or above has the same function as the query.
Homcheck allotment by tronnberg on 17 Sep 2007 16:12
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 17 Sep 2007 16:12
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 15 Sep 2007 19:16
Domain "2p0lA00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 15 Sep 2007 19:15
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2p0lA00
Flow stage update by auto on 15 Sep 2007 15:23
Retrieved PRC_PFAMCATH results for job ID SID4969563021772948 and results inserted.
Domain scan prc pfamcath by auto on 15 Sep 2007 15:22
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 3 results for 2p0lA00
Update comment by auto on 15 Sep 2007 09:16
PRC_PFAMCATH job SID4969563021772948 is not yet finished.
Prc pfamcath submit by auto on 15 Sep 2007 08:39
The entry "2p0lA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 15 Sep 2007 08:39
The entry "2p0lA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 14 Sep 2007 23:13
Retrieved SSAP results for job ID SID1353091516526952 and results inserted.
Domain scan ssap cath by auto on 14 Sep 2007 23:12
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 49 results for 2p0lA00
Update comment by auto on 09 Sep 2007 23:09
SSAP job SID1353091516526952 is not yet finished.
Ssap cath submit by auto on 09 Sep 2007 22:27
The entry "2p0lA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 22:27
The entry "2p0lA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 19:59
Giving up on SSAP job SID3982991192627818 because submission time of Wed Sep 5 16:21:48 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:59:58 2007).
Update comment by auto on 05 Sep 2007 19:44
SSAP job SID3982991192627818 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 16:21
The entry "2p0lA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 16:21
The entry "2p0lA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 10:38
Retrieved PRC results for job ID SID0428607072340640 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 10:37
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 3 results for 2p0lA00
Flow stage update by auto on 05 Sep 2007 03:57
The entry "2p0lA00" has been submitted to the PRC webservice.
Prc cath submit by auto on 05 Sep 2007 03:57
The entry "2p0lA00" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 23:21
Retrieved HMM(SAM) results for job ID SID8758600944719840 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 23:20
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2p0lA00
Update comment by auto on 04 Sep 2007 12:16
HMM(SAM) job SID8758600944719840 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 10:09
The entry "2p0lA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 10:09
The entry "2p0lA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 03:29
Retrieved "2p0lA00" CATHEDRAL results for job ID SID9490684524126080 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 03:28
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 55 results for 2p0lA00
Cathedral cath submit by auto on 03 Sep 2007 14:12
The entry "2p0lA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 14:12
The entry "2p0lA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 12:15
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2p0lA00.scanlist" for "2p0lA00"
Write scan list by auto on 03 Sep 2007 12:15
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2p0lA00.scanlist" for domain "2p0lA00"
Update comment by auto on 03 Sep 2007 10:11
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:31
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:36
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:32
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:21
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:22
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:15
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:28
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:12
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:14
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:16
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:41
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:15
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:32
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:06
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 16:16
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 10:12
Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 06:32
Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 02:37
Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 22:16
Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 14:42
Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 09:05
Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 02:23
Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 22:29
Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 18:33
Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 14:49
Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 10:14
Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 08:12
Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 02:21
Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 28 Aug 2007 02:17
No satisfactory AssignClose result found.
Flow stage update by auto on 28 Aug 2007 02:09
No in_process hits for Domain "2p0lA00" ready to be processed
Flow stage update by auto on 28 Aug 2007 02:09
NW result present for Domain "2p0lA00"
Flow stage update by auto on 21 Aug 2007 10:06
All required files are present for Domain "2p0lA00"
Flow stage update by auto on 20 Aug 2007 17:33
Beginning processing for Domain "2p0lA00"
Insertion by cuff on 20 Aug 2007 10:54
nice chopping
