CATH Domain: 2p02A01 XML data for domain: 2p02A01

Molscript image for 2p02A01
2p02A01
PDB coordinates for domain 2p02A01

PDB 2p02, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.300 GMP Synthetase; Chain A, domain 3
3.30.300.10 Gene3D
3.30.300.10.3
3.30.300.10.3.1
3.30.300.10.3.1.1
3.30.300.10.3.1.1.1
3.30.300.10.3.1.1.1.1

Segment boundaries for domain 2p02A01

Chopping figure for domain 2p02A01
DomainStart PDB ResidueStop PDB Residue
2p02A01 38 46
2p02A01 174 274
2p02A02 47 149
2p02A02 275 311
2p02A03 150 173
2p02A03 312 416

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|2p02A01
GTFLFTSESLTIVLAHKLNAKLAELRRNGTLPWLRPDSKTQVTVQYMQDRGAVLPIRVHTIVISVQHDEEVCLDEMRDAL
KEKVIKAVVPAKYLDEDTIYHLQPSGRFVI    

Domain COMBS Sequence

>pdb|2p02A01
GTFLFTSESLTIVLAHKLNAKLAELRRNGTLPWLRPDSKTQVTVQYMQDRGAVLPIRVHTIVISVQHDEEVCLDEMRDAL
KEKVIKAVVPAKYLDEDTIYHLQPSGRFVI    

Domain History Events (6)

Domain assigned by auto on 27 Jun 2007 22:28

Assigning to "3.30.300.10" based on similarity with "2hj2A01"

Flow stage update by auto on 02 Apr 2007 02:01

No in_process hits for Domain "2p02A01" ready to be processed

Flow stage update by auto on 02 Apr 2007 02:01

NW result present for Domain "2p02A01"

Flow stage update by auto on 31 Mar 2007 21:59

All required files are present for Domain "2p02A01"

Flow stage update by auto on 30 Mar 2007 21:22

Beginning processing for Domain "2p02A01"

Insertion by auto on 30 Mar 2007 21:11

Final ChopClose added based on similarity with "2hj2A"