CATH Domain: 2oztA02 XML data for domain: 2oztA02

Molscript image for 2oztA02
2oztA02
PDB coordinates for domain 2oztA02

PDB 2ozt, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.20 Alpha-Beta Barrel
3.20.20 TIM Barrel
3.20.20.120 Enolase superfamily Gene3D
3.20.20.120.12
3.20.20.120.12.1
3.20.20.120.12.1.1
3.20.20.120.12.1.1.1
3.20.20.120.12.1.1.1.1

[top]
Segment boundaries for domain 2oztA02

Chopping figure for domain 2oztA02
DomainStart PDB ResidueStop PDB Residue
2oztA01 0 103
2oztA01 307 320
2oztA02 104 306

Structural Neighbourhood (26 entries)

There are 26 matching structural neighberhood comparisons for CATH ID 3.20.20.120.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 26 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2chrA02 86.05 Ralstonia eutropha JMP134Chloromuconate cycloisomeraseToluene and xylene degradationMuconate cycloisomerase [EC:5.5.1.1]Benzoate degradation via hydroxylation 3.20.20.120 202 23 95 2.45 2.58
1r6wA01 83.97 Ubiquinone and other terpenoid-quinone biosynthesisMetabolic pathwaysMenaquinone biosynthetic processO-succinylbenzoate synthaseHydro-lyase activity 3.20.20.120 198 19 94 3.10 3.30
2pgwA02 83.27 Sinorhizobium melilotiToluene and xylene degradationBenzoate degradation via hydroxylationMuconate cycloisomerase [EC:5.5.1.1]Mandelate racemase/muconate lactonizing enzyme family protein 3.20.20.120 215 16 89 2.57 2.88
2qvhA02 82.80 Ubiquinone and other terpenoid-quinone biosynthesisThermobifida fusca YXO-succinylbenzoate-CoA synthaseO-succinylbenzoate synthase [EC:4.2.1.113]Metabolic pathways 3.20.20.120 224 27 85 2.89 3.39
1jpdX02 82.60 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.20.20.120 207 19 90 2.78 3.06
1tkkA02 82.44 Bacillus subtilisL-Ala-D/L-Glu epimerase 3.20.20.120 244 19 81 2.77 3.38
3cb3A02 81.55 Toluene and xylene degradationPolaromonas sp. JS666Mandelate racemase [EC:5.1.2.2]Mandelate racemase/muconate lactonizing enzymeBenzoate degradation via hydroxylation 3.20.20.120 233 19 81 2.76 3.38
2qdeA02 81.40 Aromatoleum aromaticum EbN1Mandelate racemase/muconate lactonizing enzyme family protein 3.20.20.120 239 20 81 2.69 3.30
2nqlA02 81.37 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.20.20.120 214 14 89 2.91 3.26
2qddA02 81.14 Mandelate racemase/muconate lactonizing enzyme, putativeRoseovarius nubinhibens ISM 3.20.20.120 236 20 81 2.65 3.26
2oqyA02 81.11 Muconate cycloisomeraseOceanobacillus iheyensis 3.20.20.120 226 15 87 2.99 3.41
3cawA02 80.76 Ubiquinone and other terpenoid-quinone biosynthesisO-succinylbenzoate synthase [EC:4.2.1.113]Bdellovibrio bacteriovorusMetabolic pathwaysPutative uncharacterized protein 3.20.20.120 225 20 84 3.35 3.99
2ovlA02 80.39 Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase 3.20.20.120 223 16 84 3.34 3.96
1mdlA02 80.03 Mandelate racemasePseudomonas putida 3.20.20.120 230 13 81 2.56 3.13
2oqhA02 79.91 Putative isomeraseStreptomyces coelicolor 3.20.20.120 240 20 79 2.79 3.51
2pozH02 79.51 Putative dehydrataseMesorhizobium loti 3.20.20.120 246 15 77 2.66 3.43
3bjsA02 79.37 Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme 3.20.20.120 250 15 77 2.64 3.42
1ec7A02 78.83 Ascorbate and aldarate metabolismD-glucarate catabolic processGlucarate dehydratase activityGlucarate dehydrataseGlucarate dehydratase [EC:4.2.1.40] 3.20.20.120 261 15 74 3.03 4.08
1tzzA02 78.79 Bradyrhizobium japonicumBll6730 protein 3.20.20.120 256 16 74 2.61 3.50
2oz8A02 78.75 Mesorhizobium lotiMll7089 protein 3.20.20.120 230 15 81 2.97 3.63
2qq6A02 78.47 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein 3.20.20.120 262 14 73 2.70 3.67
3cyjA02 78.46 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like proteinToluene and xylene degradationMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylation 3.20.20.120 235 19 79 2.96 3.72
1yeyB02 78.44 Xanthomonas campestris pv. campestrisRTS beta protein 3.20.20.120 243 17 79 3.00 3.80
2podB02 77.62 Mandelate racemase / muconate lactonizing enzymeBurkholderia pseudomallei 3.20.20.120 251 10 76 2.96 3.89
2hzgA02 76.84 Rhodobacter sphaeroides 2.4.1Mandelate racemase/muconate lactonizing enzyme/Enolase superfamily 3.20.20.120 248 16 79 3.33 4.19
3go2A02 75.74 Burkholderia xenovorans LB400Putative uncharacterized protein 3.20.20.120 268 12 71 3.25 4.56
[1]
Displaying entries 1 to 26 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2oztA02
RPWPICALLGSGQAALEQWQQSWQRGQTTFKWKVGVSPEEEQAILKALLAALPPGAKLRLDANGSWDRATANRWFAWLDR
HGNGKIEYVEQPLPPDQWQALLSLAQTVTTAIALDESVVSAAEVQRWVDRGWPGFFVIKTALFGDPDSLSLLLRRGLEPQ
RLVFSSALEGAIARTAIFHLLETWQPCHALGFGVDRWRSAPL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2oztA02
RPWPICALLGSGQAALEQWQQSWQRGQTTFKWKVGVXSPEEEQAILKALLAALPPGAKLRLDANGSWDRATANRWFAWLD
RHGNGKIEYVEQPLPPDQWQALLSLAQTVTTAIALDESVVSAAEVQRWVDRGWPGFFVIKTALFGDPDSLSLLLRRGLEP
QRLVFSSALEGAIARTAIFHLLETWQPCHALGFGVDRWRSAPL
BLAST against CATH

[top]
Domain History Events (58)

Domain assigned by cuff on 08 Mar 2008 10:17

same superfamily

Domain assignment manual match h by tronnberg on 17 Sep 2007 15:48

SSAP: 84.0 OV: 94 SEQ: 19. Similar linkage and structure. The query and match has the same function (o-succinylbenzoate synthase).

Homcheck review by tronnberg on 17 Sep 2007 15:48

SSAP: 84.0 OV: 94 SEQ: 19. Similar linkage and structure. The query and match has the same function (o-succinylbenzoate synthase).

Flow stage update by tronnberg on 17 Sep 2007 15:48

SSAP: 84.0 OV: 94 SEQ: 19. Similar linkage and structure. The query and match has the same function (o-succinylbenzoate synthase).

Homcheck allotment by tronnberg on 17 Sep 2007 15:44

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 17 Sep 2007 15:44

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 19:14

Domain "2oztA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 19:13

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2oztA02

Flow stage update by auto on 15 Sep 2007 15:21

Retrieved PRC_PFAMCATH results for job ID SID3083447374980390 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 15:20

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 99 results for 2oztA02

Update comment by auto on 15 Sep 2007 09:16

PRC_PFAMCATH job SID3083447374980390 is not yet finished.

Prc pfamcath submit by auto on 15 Sep 2007 08:39

The entry "2oztA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 08:39

The entry "2oztA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 14 Sep 2007 23:11

Retrieved SSAP results for job ID SID0257929898510753 and results inserted.

Domain scan ssap cath by auto on 14 Sep 2007 23:09

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1101 results for 2oztA02

Update comment by auto on 09 Sep 2007 23:09

SSAP job SID0257929898510753 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:26

The entry "2oztA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:26

The entry "2oztA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 19:59

Giving up on SSAP job SID5003391400741392 because submission time of Wed Sep 5 16:21:26 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:59:46 2007).

Update comment by auto on 05 Sep 2007 19:43

SSAP job SID5003391400741392 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 16:21

The entry "2oztA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 16:21

The entry "2oztA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 10:36

Retrieved PRC results for job ID SID8501603976475392 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 10:34

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 34 results for 2oztA02

Prc cath submit by auto on 05 Sep 2007 03:56

The entry "2oztA02" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 03:56

The entry "2oztA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 23:19

Retrieved HMM(SAM) results for job ID SID5571877519237824 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 23:18

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 34 results for 2oztA02

Update comment by auto on 04 Sep 2007 12:16

HMM(SAM) job SID5571877519237824 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:08

The entry "2oztA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:08

The entry "2oztA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 03:27

Retrieved "2oztA02" CATHEDRAL results for job ID SID4112924777873952 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 03:26

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 129 results for 2oztA02

Cathedral cath submit by auto on 03 Sep 2007 14:12

The entry "2oztA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:12

The entry "2oztA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:15

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2oztA02.scanlist" for "2oztA02"

Write scan list by auto on 03 Sep 2007 12:14

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2oztA02.scanlist" for domain "2oztA02"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:36

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:21

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:22

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:15

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:28

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:12

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:14

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:16

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:41

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:15

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:32

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:06

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 31 Aug 2007 20:01

No satisfactory AssignClose result found.

Flow stage update by auto on 31 Aug 2007 19:48

No in_process hits for Domain "2oztA02" ready to be processed

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2oztA02"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2oztA02"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2oztA02"

Insertion by cuff on 23 Aug 2007 12:19

nice chopping