CATH Domain: 2oztA01 XML data for domain: 2oztA01

Molscript image for 2oztA01
2oztA01
PDB coordinates for domain 2oztA01

PDB 2ozt, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.10 Enolase-like, N-terminal domain Gene3D
3.30.390.10.5
3.30.390.10.5.1
3.30.390.10.5.1.1
3.30.390.10.5.1.1.1
3.30.390.10.5.1.1.1.1

[top]
Segment boundaries for domain 2oztA01

Chopping figure for domain 2oztA01
DomainStart PDB ResidueStop PDB Residue
2oztA01 0 103
2oztA01 307 320
2oztA02 104 306

Structural Neighbourhood (16 entries)

There are 16 matching structural neighberhood comparisons for CATH ID 3.30.390.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 16 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2zadA01 84.77 Thermotoga maritimaL-Ala-D/L-Glu epimerase 3.30.390.10 109 12 83 3.08 3.68
1tkkA01 83.96 Bacillus subtilisL-Ala-D/L-Glu epimerase 3.30.390.10 115 13 86 2.99 3.46
1nu5A01 83.89 Chloromuconate cycloisomerasePseudomonas sp. P51 3.30.390.10 116 13 85 2.87 3.36
2pmqA01 82.92 Roseovarius sp. HTCC2601Mandelate racemase/muconate lactonizing enzyme 3.30.390.10 127 15 87 3.04 3.48
3dgbA01 82.63 Muconate cycloisomeraseToluene and xylene degradationMuconate cycloisomerase [EC:5.5.1.1]Benzoate degradation via hydroxylationMetabolic pathways 3.30.390.10 134 16 83 3.08 3.69
1jpdX01 82.60 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.30.390.10 99 18 77 2.83 3.64
3fv9D01 81.67 Mandelate racemase/muconate lactonizing enzyme, putativeRoseovarius nubinhibens ISM 3.30.390.10 130 11 81 2.85 3.50
2ovlA01 81.56 Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase 3.30.390.10 123 19 82 3.28 3.99
1mdlA01 79.90 Mandelate racemasePseudomonas putida 3.30.390.10 126 16 81 3.39 4.15
3go2A01 79.64 Burkholderia xenovorans LB400Putative uncharacterized protein 3.30.390.10 114 12 78 3.28 4.17
3cawA01 79.26 Ubiquinone and other terpenoid-quinone biosynthesisO-succinylbenzoate synthase [EC:4.2.1.113]Bdellovibrio bacteriovorusMetabolic pathwaysPutative uncharacterized protein 3.30.390.10 91 16 72 3.46 4.76
3bjsA01 79.18 Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme 3.30.390.10 116 14 81 4.00 4.93
2og9A01 79.10 Toluene and xylene degradationPolaromonas sp. JS666Mandelate racemase [EC:5.1.2.2]Mandelate racemase/muconate lactonizing enzymeBenzoate degradation via hydroxylation 3.30.390.10 129 10 72 3.12 4.28
2qq6B01 78.02 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein 3.30.390.10 115 11 79 3.56 4.48
2pgwA01 77.92 Sinorhizobium melilotiToluene and xylene degradationBenzoate degradation via hydroxylationMuconate cycloisomerase [EC:5.5.1.1]Mandelate racemase/muconate lactonizing enzyme family protein 3.30.390.10 147 17 72 3.05 4.23
2oqyA01 77.33 Muconate cycloisomeraseOceanobacillus iheyensis 3.30.390.10 142 13 74 3.65 4.89
[1]
Displaying entries 1 to 16 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2oztA01
SLRWQWRIYEEPLQEPLTTAQGVWRSRSGIYLRLEDEQGQVGYGEIAPLPGWGSETLNADIALCQQLPGHLTPEIATIPE
ALPAAQFGFATAWQSVGRLPYRVLTTLTAYERLWERL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2oztA01
XSLRWQWRIYEEPLQEPLTTAQGVWRSRSGIYLRLEDEQGQVGYGEIAPLPGWGSETLNADIALCQQLPGHLTPEIXATI
PEALPAAQFGFATAWQSVGRLPYRVLTTLTAYERLWERLDQEGHHHHHH
BLAST against CATH

[top]
Domain History Events (58)

Domain assigned by cuff on 08 Mar 2008 10:29

same superfamily

Domain assignment manual match h by tronnberg on 17 Sep 2007 15:43

SSAP: 84.6 OV: 91 SEQ: 18. Similar linkage and structure. The query and match has the same function as o-succinylbenzoate synthase.

Homcheck review by tronnberg on 17 Sep 2007 15:43

SSAP: 84.6 OV: 91 SEQ: 18. Similar linkage and structure. The query and match has the same function as o-succinylbenzoate synthase.

Flow stage update by tronnberg on 17 Sep 2007 15:43

SSAP: 84.6 OV: 91 SEQ: 18. Similar linkage and structure. The query and match has the same function as o-succinylbenzoate synthase.

Homcheck allotment by tronnberg on 17 Sep 2007 15:40

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 17 Sep 2007 15:40

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 19:13

Domain "2oztA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 19:12

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2oztA01

Flow stage update by auto on 15 Sep 2007 15:20

Retrieved PRC_PFAMCATH results for job ID SID1209845944549977 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 15:19

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 32 results for 2oztA01

Update comment by auto on 15 Sep 2007 09:16

PRC_PFAMCATH job SID1209845944549977 is not yet finished.

Prc pfamcath submit by auto on 15 Sep 2007 08:39

The entry "2oztA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 08:39

The entry "2oztA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 14 Sep 2007 23:09

Retrieved SSAP results for job ID SID3982554293166166 and results inserted.

Domain scan ssap cath by auto on 14 Sep 2007 23:07

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1875 results for 2oztA01

Update comment by auto on 09 Sep 2007 23:09

SSAP job SID3982554293166166 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:26

The entry "2oztA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:26

The entry "2oztA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 19:59

Giving up on SSAP job SID8598362953633344 because submission time of Wed Sep 5 16:21:16 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:59:40 2007).

Update comment by auto on 05 Sep 2007 19:43

SSAP job SID8598362953633344 is not yet finished.

Flow stage update by auto on 05 Sep 2007 16:21

The entry "2oztA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 16:21

The entry "2oztA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 10:34

Retrieved PRC results for job ID SID2711877541423904 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 10:33

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 29 results for 2oztA01

Flow stage update by auto on 05 Sep 2007 03:56

The entry "2oztA01" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 03:56

The entry "2oztA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 23:18

Retrieved HMM(SAM) results for job ID SID5669914082453824 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 23:17

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 17 results for 2oztA01

Update comment by auto on 04 Sep 2007 12:15

HMM(SAM) job SID5669914082453824 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:08

The entry "2oztA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:08

The entry "2oztA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 03:26

Retrieved "2oztA01" CATHEDRAL results for job ID SID4806171389241728 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 03:25

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 34 results for 2oztA01

Cathedral cath submit by auto on 03 Sep 2007 14:12

The entry "2oztA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:12

The entry "2oztA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:14

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2oztA01.scanlist" for "2oztA01"

Write scan list by auto on 03 Sep 2007 12:14

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2oztA01.scanlist" for domain "2oztA01"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:36

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:21

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:22

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:15

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:28

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:12

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:14

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:16

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:41

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:15

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:32

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:06

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 31 Aug 2007 20:01

No satisfactory AssignClose result found.

Flow stage update by auto on 31 Aug 2007 19:48

No in_process hits for Domain "2oztA01" ready to be processed

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2oztA01"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2oztA01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2oztA01"

Insertion by cuff on 23 Aug 2007 12:19

nice chopping